Property Summary

NCBI Gene PubMed Count 44
PubMed Score 506.87
PubTator Score 107.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 2.300 9.8e-04
hepatocellular carcinoma 1.600 6.4e-03
pancreatic cancer 3.200 4.3e-03
cutaneous lupus erythematosus 3.400 6.3e-03
osteosarcoma -6.143 7.3e-17
periodontitis 2.400 2.1e-27
tuberculosis 2.000 6.1e-03
colon cancer -3.000 1.9e-07
lung cancer -2.900 2.3e-06
interstitial cystitis 4.000 4.1e-03
primary Sjogren syndrome 1.600 2.8e-04
pancreatic carcinoma 3.200 4.3e-03
mucosa-associated lymphoid tissue lympho... 1.035 4.8e-02
ulcerative colitis 3.200 1.3e-05
cystic fibrosis and chronic rhinosinusit... 1.077 3.4e-02

Protein-protein Interaction (10)

Gene RIF (33)

PMID Text
26914861 results suggest that Akt and JNK pathways are involved in the regulation of B-cell maturation antigen (BCMA)
26065893 shedding of BCMA by gamma-secretase controls plasma cells in the bone marrow and yields a potential biomarker for B-cell involvement in human autoimmune diseases
25759827 elevated serum levels in patients with Behcet's disease
25750171 High BCMA expression is associated with breast cancer.
25301447 Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies.
24376672 BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis)
23776238 B-cell maturation antigen (BCMA), an essential membrane protein for maintaining the survival of plasma cells, was identified as a glycoprotein exhibiting complex-type N-glycans at a single N-glycosylation site, asparagine 42.
23728352 Data indicate that MAGE3, Survivin and B-cell maturation antigen (BCMA) mRNA-pulsed dendritic cells (DCs) are capable of stimulating tumor-associated antigens (TAA)-specific T-cell responses in multiple myeloma (MM) patients.
23344265 Data indicate that B-cell maturation antigen (BCMA) is a suitable target for chimeric antigen receptor (CAR)-expressing T cells, and adoptive transfer of anti-BCMA-CAR-expressing T cells is a promising new strategy for treating multiple myeloma.
23237506 The B cell maturation antigen (BCMA) is a tumor necrosis family receptor member that is predominantly expressed on terminally differentiated B cells and, upon binding to its ligands B cell activator of the TNF family and a proliferation inducing ligand.
23088438 Activation of B cells through BCMA regulates spinal cord injury-induced autoimmunity via a proliferation-inducing ligand (APRIL) and B-cell-activating factor (BAFF).
23071284 the effect of APRIL is mediated via BCMA, which does not activate the classical NF-kappaB pathway, whereas it induces a novel signaling pathway, which involves JNK2 phosphorylation, FOXO3A activation, and GADD45 transcription
22804669 Serum BCMA levels were higher among patients with progressive disease than those with responsive disease. Overall survival was shorter among patients whose serum BCMA levels were above the median.
22166983 These data advance BCMA as an inflammation-related TNF superfamily member in keratinocytes, of potential importance in the management of inflammatory skin conditions.
22108903 TNFRSF17 may be a candidate gene associated with the pathogenesis of colon cancer.
21687682 primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI
21483105 This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma.
21250838 Signaling through BCMA enhances B cell activation following exposure to TLR9 agonists, and increased expression in SLE may contribute to the production of IgG autoantibodies.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20016944 genetic polymorphisms are associated with gastrointestinal disorders
20016944 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19741596 we observed APRIL expression, together with TACI and BCMA in gut-associated lymphoid tissue, lamina propria, and in the epithelium of stomach, small and large intestine, and rectum.
18025170 Expression of B cell maturation Ag (BCMA) is also highly regulated and we demonstrate that BCMA expression is only acquired in MB cells and in a manner accompanied by loss of BAFF-R expression.
17968879 rheumatoid arthritis fibroblast like synoviocytes are stimulated by APRIL and express the APRIL receptor BCMA
17825416 BCMA TVs were observed only in some CD19+ cell samples.
16960154 The BCMA inhibited HRS cell accumulation in vitro and might attenuate HL expansion in vivo.
16931039 Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation.
16919470 Review. APRIL interactions with BCMA likely govern memory B cell populations.
15692072 BCMA is a target of donor B-cell immunity in patients with myeloma who respond to Donor lymphocyte infusions
15542592 APRIL.TACI_d2 and APRIL.BCMA complexes together reveal the mechanism by which TACI engages high affinity ligand binding through a single cysteine-rich domain
15301860 Observational study of genotype prevalence. (HuGE Navigator)
14512299 Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival.

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAV      1 - 70
FVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDS     71 - 140
DHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR                              141 - 184
//

Text Mined References (46)

PMID Year Title
26914861 2016 Binding of B-cell maturation antigen to B-cell activating factor induces survival of multiple myeloma cells by activating Akt and JNK signaling pathways.
26065893 2015 ?-Secretase directly sheds the survival receptor BCMA from plasma cells.
25759827 2014 Expression of TNF-?, APRIL and BCMA in Behcet's disease.
25750171 2015 APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.
25301447 2014 Expression of BAFF receptors in muscle tissue of myositis patients with anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies.
24376672 2013 BAFF, APRIL, TWEAK, BCMA, TACI and Fn14 proteins are related to human glioma tumor grade: immunohistochemistry and public microarray data meta-analysis.
23776238 2013 B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention.
23728352 2013 Immunogenicity of dendritic cells pulsed with MAGE3, Survivin and B-cell maturation antigen mRNA for vaccination of multiple myeloma patients.
23344265 2013 B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma.
23237506 2012 Regulatory roles of the tumor necrosis factor receptor BCMA.
23088438 2013 B-cell maturation antigen, a proliferation-inducing ligand, and B-cell activating factor are candidate mediators of spinal cord injury-induced autoimmunity.
23071284 2012 APRIL binding to BCMA activates a JNK2-FOXO3-GADD45 pathway and induces a G2/M cell growth arrest in liver cells.
22804669 2012 Serum B-cell maturation antigen is elevated in multiple myeloma and correlates with disease status and survival.
22166983 2012 B-cell maturation antigen (BCMA) activation exerts specific proinflammatory effects in normal human keratinocytes and is preferentially expressed in inflammatory skin pathologies.
22108903 2012 The haplotypes of TNFRSF17 polymorphisms are associated with colon cancer in a Korean population.
21687682 2011 Aberrant expression of functional BAFF-system receptors by malignant B-cell precursors impacts leukemia cell survival.
21483105 2011 Detection of the TNFSF members BAFF, APRIL, TWEAK and their receptors in normal kidney and renal cell carcinomas.
21250838 2011 Increased BCMA expression in lupus marks activated B cells, and BCMA receptor engagement enhances the response to TLR9 stimulation.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20016944 2010 Identification of single nucleotide polymorphisms in the TNFRSF17 gene and their association with gastrointestinal disorders.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19741596 2009 Gut-associated lymphoid tissue contains the molecular machinery to support T-cell-dependent and T-cell-independent class switch recombination.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
18025170 2007 Regulated expression of BAFF-binding receptors during human B cell differentiation.
17968879 2007 Rheumatoid arthritis fibroblast-like synoviocytes express BCMA and are stimulated by APRIL.
17825416 2008 Identification of new splice variants of the genes BAFF and BCMA.
16960154 2007 Hodgkin lymphoma cells express TACI and BCMA receptors and generate survival and proliferation signals in response to BAFF and APRIL.
16931039 2006 The role of the BAFF/APRIL system on T cell function.
16919470 2006 BLyS receptor signatures resolve homeostatically independent compartments among naïve and antigen-experienced B cells.
15692072 2005 Graft-versus-tumor response in patients with multiple myeloma is associated with antibody response to BCMA, a plasma-cell membrane receptor.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15542592 2005 Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
14512299 2004 Expression of BCMA, TACI, and BAFF-R in multiple myeloma: a mechanism for growth and survival.
12721620 2003 Ligand-receptor binding revealed by the TNF family member TALL-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528522 2001 Presence of four major haplotypes in human BCMA gene: lack of association with systemic lupus erythematosus and rheumatoid arthritis.
10973284 2000 APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity.
10908663 2000 B cell maturation protein is a receptor for the tumor necrosis factor family member TALL-1.
10903733 2000 TNF receptor family member BCMA (B cell maturation) associates with TNF receptor-associated factor (TRAF) 1, TRAF2, and TRAF3 and activates NF-kappa B, elk-1, c-Jun N-terminal kinase, and p38 mitogen-activated protein kinase.
10801128 2000 TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
8527407 1995 BCMAp: an integral membrane protein in the Golgi apparatus of human mature B lymphocytes.
8165126 1994 The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed.
1396583 1992 A new gene, BCM, on chromosome 16 is fused to the interleukin 2 gene by a t(4;16)(q26;p13) translocation in a malignant T cell lymphoma.