Property Summary

NCBI Gene PubMed Count 102
PubMed Score 191.54
PubTator Score 159.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.216 1.6e-03
diabetes mellitus 1.500 1.3e-03
ovarian cancer -1.400 1.3e-05

 GO Function (1)

Gene RIF (91)

PMID Text
27123465 11% of common variable immunodeficiency patients and 13% of antibody deficiency syndromes patients carried at least one mutated TNFRSF13B allele.
26727773 C104R mutation was associated with common variable immunodeficiency and IgG subclass deficiency.
26268376 SNPs rs9514828 (BAFF), rs3803800 (APRIL) and rs4985726 (TACI) may be associated with the risk of development of B-cell chronic lymphocytic leukemia in a Polish population.
26122175 Variants of TNFRSF13B were associated with common variable immunodeficiency.
26100089 TNFRSF13B hemizygosity does not recapitulate autoimmune features of common variable immune deficiency -associated C104R and A181E TNFRSF13B mutations, which likely encode dominant negative products, but instead reveals selective TACI haploinsufficiency at later stages of B-cell development.
26096648 In this review, we aim at giving an insight into the genetics underlying the CVID and particularly at outlining the role of TACI and its relative contribution to the development of CVID-like phenotypes in human.
25950010 The study demonstrated that there is a remarkable interindividual variability of TACI expression in chronic lymphocytic leukemia, although the majority of patients display low to undetectable TACI.
25866827 Common variable immune deficiency patients with heterozygous mutations in TACI alleles increase susceptibility to autoimmune diseases.
25723853 only Transmembrane Activator and CAML Interactor (TACI) correlates with the MMC's capability to ligate BAFF. Additionally, the level of expression of TACI correlates with the level of the MMC's BM dependency
25631768 Although the transcriptional controls for alternative splicing of TACI isoforms remain unknown, differential signals via isoforms may control plasma-cell generation.
25567522 serum levels not associated with disease activity in MPO-ANCA-associated renal vasculitis
25505277 The released sTACI is an immunoregulator that shares decoy functions with atacicept. It reflects systemic and compartmentalized B cell accumulation and activation.
25301447 Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies.
25162001 In conclusion, we confirmed the prognostic significance of soluble BLyS levels with regard to TFT in CLL patients, and, more importantly, we showed for the first time that sTACI is a powerful prognostic marker, related to parameters of disease activity
24809296 Availability of BAFF determines BAFF-R and TACI expression on B cells in common variable immunodeficiency.
24376672 BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis)
24051380 TACI mutations enables autoimmune complications in common variable immune deficiency .
23956760 TNFRSF13B/TACI defects alone do not result in CVID but may be also found frequently in distinct clinical phenotypes, including benign lymphoproliferation and IgG subclass deficiencies.
23932459 genetic polymorphism is associated with lung function in Hutterites, who are a founder population of European descent in North America
23620746 The ability of TACI-Fc to activate reverse signalling through BAFF and APRIL, was investigated.
23418049 Our results revealed two novel genes (IGF2BP2 and TNFRSF13B), whose function could account for the biologic pathways influencing MetS phenotypes.
23336587 Up-regulation of BLyS and its receptors, especially TACI are observed in patients with systemic lupus erythematosus.
23237420 Intracellular and extracellular TACI expression was defective for B cells of all subjects with mutations.
23225259 Naturally occurring mutation affecting the MyD88-binding site of TNFRSF13B impairs triggering of class switch recombination.
22983507 Segregation analysis of a kindred shows that inheriting single or double copy of the Cys104Arg mutation does not necessarily consign an individual to common variable immunodeficiency (CVID).
22884984 A significant association of TNFRSF13B gene mutations was observed in common variable immunodeficiency patients.
22697072 Data suggest a different impact of TACI mutations, from hypogammaglobulinemia in children to autoimmune disease in adulthood.
22673310 Three SNPs located in TNFRSF13B on 17p11.2 or nearby were significantly associated with IgG level.
22627058 Two pediatric Italian male siblings were affected with hypogammaglobulinemia and recurrent respiratory and gastrointestinal infections in association with a novel compound heterozygous I87N/C104R TACI mutation.
22076597 the identification of two novel mutations in TNFRSF13B, including one, S231R, affecting the highly conserved THC domain
21850030 We conclude that mutations in TACI are the contributing factors for asthma symptoms in Swedish children, although the mechanisms still remain elusive.
21741080 Signals from TLR9, TACI, and CD40 are integrated to promote B-cell activation and differentiation.
21687682 primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI
21547394 Our data provide further evidence that TNFRSF13B/TACI alterations are not causative of common variable immunodeficiency
21514638 In patients with Smith-Magenis syndrome with only 1 TACI allele, we found decreased B-cell expression of TACI, reduced binding of a proliferation-inducing ligand, and decreased TACI-induced expression of activation-induced cytidine deaminase mRNA.
21419480 We have examined the function of TACI coding variants that have been described in patients with common variable immunodeficiency
20974656 TACI expression on CD19+ B cells was up-regulated in patients with lupus nephritis
20889194 mutations result in impaired B cell response through haploinsufficiency
20676093 MyD88 controls a B cell-intrinsic, TIR-independent, TACI-dependent pathway for immunoglobulin diversification
20568250 Observational study of gene-disease association. (HuGE Navigator)
20156508 the TNFRSF13B A181E mutation is associated with a very heterogeneous clinical presentation along with variability in B-cell numbers and amount of TACI protein on memory B cells in Common Variable ImmunoDeficiency
20156508 Observational study of gene-disease association. (HuGE Navigator)
20006554 Observational study of gene-disease association. (HuGE Navigator)
19775471 TACI mutations are unlikely to play a critical role in creating susceptibility to CVID among patients with previously recognized MHC class I and class II susceptibility alleles
19775471 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19741596 we observed APRIL expression, together with TACI and BCMA in gut-associated lymphoid tissue, lamina propria, and in the epithelium of stomach, small and large intestine, and rectum.
19629655 novel mutations identified in this study support the notion of a crucial role for TACI in B cell differentiation
19629655 Observational study of gene-disease association. (HuGE Navigator)
19605846 mTACI A144E mutation and its human counterpart, A181E, disrupt TACI signaling and impair TACI-dependent B-cell functions.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19494827 Single Nucleotide Polymorphisms in TNFRSF13B is associated with common variable immunodeficiency.
19494827 Observational study of gene-disease association. (HuGE Navigator)
19456850 syndecan-1 is a co-receptor for APRIL and TACI at the cell surface of MMC, promoting the activation of an APRIL/TACI pathway that induces survival and proliferation in multiple myeloma cells
19392801 our work seems to discard a role of TNFRSF13B mutations in IgA Deficiency, concordantly with the most recent published studies.
19392801 Observational study of gene-disease association. (HuGE Navigator)
19321861 role for APRIL-TACI-specific signaling in follicular lymphoma B-cell growth
19291294 overexpression in multiple myeloma and thyroid carcinoma; association with poor prognosis in lymphoma
19210517 TNFRSF13B mutations induce disease susceptibility rather than cause common variable immunodeficiency directly
19207947 There was a variable pattern of expression of TACI amongst the different types of B-cell lymphomas
19074885 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19028483 BLyS protein concentration and BLyS, TACI and BAFF-R mRNA expression levels were significantly elevated in patients with multiple myeloma.
18981294 C104R heterozygosity increases the risk for common variable immunodeficiency disorders and influences clinical presentation.
18981294 Observational study of gene-disease association. (HuGE Navigator)
18978466 mutated in nearly 10% of patients with common variable immune deficiency
18051214 Of 9 CVID patients...No mutations of SAP, ICOS, TACI, BAFFR, and CD19 were identified
18046446 APRIL plays an essential role in the survival of TACI(high) bone marrow-dependent myeloma cells and TACI gene expression may be a useful predictive marker for patients who could benefit from atacicept treatment
18025170 The TACI is inducible early upon B cell activation and this is independent of B cell turnover, and TACI expression requires activation of the ERK1/2 pathway.
17983875 Mutations in TACI significantly predispose to autoimmunity and lymphoid hyperplasia in common variable immunodeficiency.
17917015 These results suggest that TACI mutations can lead to CVID.
17550853 TACI activation can upregulate c-maf expression which, in turn, controls cyclin D2, and integrin beta7 gene expression in human myeloma cell lines
17539903 Observational study of gene-disease association. (HuGE Navigator)
17492055 TACI preassembles as an oligomeric complex prior to ligand binding
17464555 Observational study of gene-disease association. (HuGE Navigator)
17464555 We analyzed TACI in humans with SLE and found 4 variants: R20C in exon 1, R72H in exon 3, the silent variation c.327 G > A in exon 3, and A181E in exon 4. No significant association of SLE with any of these variants was found.
17392798 Role of TACI coding variants in common variable immunodeficiency and selective IgA deficiency.
17392797 Role of TACI coding variants in common variable immunodeficiency and selective IgA deficiency.
17171762 This review defines the exact contribution of TACI receptor stimulation by specific triggers in vitro, enabling us to better understand the complex, context-dependent responses initiated by TACI in vivo.
17154264 TACI-specific signaling inhibits both B cell activating factor of the TNF family receptor (BAFF-R) and CD40-enhanced antibody production from peripheral blood B cells in vitro, although TACI-specific signaling directly induces mild B cell apoptosis.
17119122 simultaneous binding of TACI and HSPG on B cells with APRIL is crucial for IgA production
16960154 The TACI inhibited HRS cell accumulation in vitro and might attenuate HL expansion in vivo.
16931039 Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation.
16919470 Review. Short-lived antibody forming cell populations and their proliferating progenitors express a TACI-predominant signature.
16914324 Review. The splice variants, binding specificities, structural determinants for ligand selectivity, and signaling pathways are reviewed.
16618819 Observational study of gene-disease association. (HuGE Navigator)
16007087 identified homozygous and heterozygous mutations in TNFRSF13B, encoding TACI, in 13 individuals with common variable immunodeficiency
16007086 4 of 19 unrelated individuals with common variable immunodeficiency and 1 of 16 individuals with IgA deficiency had a missense mutation in one allele of TNFRSF13B
15827134 TACI(hi) myeloma cells displayed a mature plasma cell gene signature, indicating dependence on the BM environment. In contrast, the TACI(lo) group had a gene signature of plasmablasts, suggesting an attenuated dependence on the BM environment
15542592 another form of TACI exists wherein the N-terminal cysteine-rich domain (CRD) is removed by alternative splicing and is capable of ligand-induced cell signaling and that the second CRD alone (TACI_d2) contains full affinity for both APRIL and BAFF
14512299 Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival.

AA Sequence

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLS      1 - 70
CRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLE     71 - 140
HRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQ    141 - 210
DHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLG    211 - 280
IVCVPAQEGGPGA                                                             281 - 293
//

Text Mined References (104)

PMID Year Title
27123465 2016 Clinical Associations of Biallelic and Monoallelic TNFRSF13B Variants in Italian Primary Antibody Deficiency Syndromes.
26727773 2015 Incidence of the C104R TACI Mutation in Patients With Primary Antibody Deficiency.
26268376 2015 Polymorphisms in genes of the BAFF/APRIL system may constitute risk factors of B-CLL--a preliminary study on a Polish population.
26122175 2015 Application of whole genome and RNA sequencing to investigate the genomic landscape of common variable immunodeficiency disorders.
26100089 2015 TNF receptor superfamily member 13b (TNFRSF13B) hemizygosity reveals transmembrane activator and CAML interactor haploinsufficiency at later stages of B-cell development.
26096648 2015 Genetics of common variable immunodeficiency: role of transmembrane activator and calcium modulator and cyclophilin ligand interactor.
25950010 2015 TACI expression and signaling in chronic lymphocytic leukemia.
25866827 2015 Effect of TACI signaling on humoral immunity and autoimmune diseases.
25723853 2015 B-cell activating factor in the pathophysiology of multiple myeloma: a target for therapy?
25631768 2015 Differential induction of plasma cells by isoforms of human TACI.
25567522 2015 Serum soluble levels of the transmembrane activator and calcium-modulator and cyclophilin-ligand interactor in MPO-ANCA-associated renal vasculitis.
25505277 2015 The immunoregulator soluble TACI is released by ADAM10 and reflects B cell activation in autoimmunity.
25416956 2014 A proteome-scale map of the human interactome network.
25301447 2014 Expression of BAFF receptors in muscle tissue of myositis patients with anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies.
25162001 2014 Serum soluble TACI, a BLyS receptor, is a powerful prognostic marker of outcome in chronic lymphocytic leukemia.
24809296 2014 Reduced BAFF-R and increased TACI expression in common variable immunodeficiency.
24376672 2013 BAFF, APRIL, TWEAK, BCMA, TACI and Fn14 proteins are related to human glioma tumor grade: immunohistochemistry and public microarray data meta-analysis.
24051380 2013 CVID-associated TACI mutations affect autoreactive B cell selection and activation.
23956760 2013 Heterozygous alterations of TNFRSF13B/TACI in tonsillar hypertrophy and sarcoidosis.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23620746 2013 No evidence that soluble TACI induces signalling via membrane-expressed BAFF and APRIL in myeloid cells.
23418049 2013 QTL-based association analyses reveal novel genes influencing pleiotropy of metabolic syndrome (MetS).
23336587 2013 The effect of BLyS on the activity of peripheral B lymphocytes mediated by BLyS receptors in patients with systemic lupus erythematosus.
23303382 2013 Genome-wide association study of serum albumin:globulin ratio in Korean populations.
23237420 2013 TACI mutations and impaired B-cell function in subjects with CVID and healthy heterozygotes.
23225259 2013 Naturally occurring mutation affecting the MyD88-binding site of TNFRSF13B impairs triggering of class switch recombination.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22983507 2013 Clinical variability of family members with the C104R mutation in transmembrane activator and calcium modulator and cyclophilin ligand interactor (TACI).
22884984 2012 Sequence variants of the TNFRSF13B gene in Czech CVID and IgAD patients in the context of other populations.
22697072 The impact of TACI mutations: from hypogammaglobulinemia in infancy to autoimmunity in adulthood.
22673310 2012 Genome-wide association study identifies common variants at TNFRSF13B associated with IgG level in a healthy Chinese male population.
22627058 2012 A novel compound heterozygous TACI mutation in an autosomal recessive common variable immunodeficiency (CVID) family.
22558069 2012 Association of common variants in TNFRSF13B, TNFSF13, and ANXA3 with serum levels of non-albumin protein and immunoglobulin isotypes in Japanese.
22076597 2012 Immunological characteristics and two novel mutations in TACI in a cohort of 28 pediatric patients with common variable immunodeficiency.
21850030 2012 Rare mutations in TNFRSF13B increase the risk of asthma symptoms in Swedish children.
21741080 2011 Toll-like receptor 9, transmembrane activator and calcium-modulating cyclophilin ligand interactor, and CD40 synergize in causing B-cell activation.
21687682 2011 Aberrant expression of functional BAFF-system receptors by malignant B-cell precursors impacts leukemia cell survival.
21547394 2011 TNFRSF13B/TACI alterations in Greek patients with antibody deficiencies.
21514638 2011 Transmembrane activator and CAML interactor (TACI) haploinsufficiency results in B-cell dysfunction in patients with Smith-Magenis syndrome.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21419480 2011 Functional analysis of transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI) mutations associated with common variable immunodeficiency.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20974656 2010 Expressions of BAFF/BAFF receptors and their correlation with disease activity in Chinese SLE patients.
20889194 2010 The C104R mutant impairs the function of transmembrane activator and calcium modulator and cyclophilin ligand interactor (TACI) through haploinsufficiency.
20676093 2010 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20156508 2010 Phenotypic and clinical heterogeneity associated with monoallelic TNFRSF13B-A181E mutations in common variable immunodeficiency.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20006554 2010 Lymphocyte characteristics in children with common variable immunodeficiency.
19775471 2009 Analysis of TACI mutations in CVID & RESPI patients who have inherited HLA B*44 or HLA*B8.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19741596 2009 Gut-associated lymphoid tissue contains the molecular machinery to support T-cell-dependent and T-cell-independent class switch recombination.
19629655 2009 Novel mutations in TACI (TNFRSF13B) causing common variable immunodeficiency.
19605846 2009 The murine equivalent of the A181E TACI mutation associated with common variable immunodeficiency severely impairs B-cell function.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19494827 2009 An evolutionary approach to the medical implications of the tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) gene.
19456850 2009 APRIL and TACI interact with syndecan-1 on the surface of multiple myeloma cells to form an essential survival loop.
19392801 2009 Role of polymorphisms in the TNFRSF13B (TACI) gene in Spanish patients with immunoglobulin A deficiency.
19321861 2009 A proliferation-inducing ligand mediates follicular lymphoma B-cell proliferation and cyclin D1 expression through phosphatidylinositol 3-kinase-regulated mammalian target of rapamycin activation.
19291294 2009 APRIL is overexpressed in cancer: link with tumor progression.
19210517 2009 TACI mutations and disease susceptibility in patients with common variable immunodeficiency.
19207947 2009 Expression of BAFF-R and TACI in reactive lymphoid tissues and B-cell lymphomas.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19028483 2009 Correlation of expression levels of BLyS and its receptors with multiple myeloma.
18981294 2009 Relevance of biallelic versus monoallelic TNFRSF13B mutations in distinguishing disease-causing from risk-increasing TNFRSF13B variants in antibody deficiency syndromes.
18978466 2008 Transmembrane activator and calcium-modulator and cyclophilin ligand interactor mutations in common variable immunodeficiency.
18051214 2007 Analysis of genetic defects in patients with the common variable immunodeficiency phenotype in a single Taiwanese tertiary care hospital.
18046446 2008 Atacicept (TACI-Ig) inhibits growth of TACI(high) primary myeloma cells in SCID-hu mice and in coculture with osteoclasts.
18025170 2007 Regulated expression of BAFF-binding receptors during human B cell differentiation.
17983875 2007 Transmembrane activator and calcium-modulating cyclophilin ligand interactor mutations in common variable immunodeficiency: clinical and immunologic outcomes in heterozygotes.
17917015 2007 TACI, isotype switching, CVID and IgAD.
17550853 2007 TACI expression is associated with a mature bone marrow plasma cell signature and C-MAF overexpression in human myeloma cell lines.
17539903 2007 Gender, genotype, and phenotype differences in Smith-Magenis syndrome: a meta-analysis of 105 cases.
17492055 2007 Dominant-negative effect of the heterozygous C104R TACI mutation in common variable immunodeficiency (CVID).
17464555 2007 Sequence analysis of TNFRSF13b, encoding TACI, in patients with systemic lupus erythematosus.
17392798 2007 Reexamining the role of TACI coding variants in common variable immunodeficiency and selective IgA deficiency.
17392797 2007 Reexamining the role of TACI coding variants in common variable immunodeficiency and selective IgA deficiency.
17171762 2007 To switch or not to switch--the opposing roles of TACI in terminal B cell differentiation.
17154264 2007 TACI attenuates antibody production costimulated by BAFF-R and CD40.
17119122 2007 TACI regulates IgA production by APRIL in collaboration with HSPG.
16960154 2007 Hodgkin lymphoma cells express TACI and BCMA receptors and generate survival and proliferation signals in response to BAFF and APRIL.
16931039 2006 The role of the BAFF/APRIL system on T cell function.
16919470 2006 BLyS receptor signatures resolve homeostatically independent compartments among naïve and antigen-experienced B cells.
16914324 2006 BAFF, APRIL and their receptors: structure, function and signaling.
16618819 2006 Search on chromosome 17 centromere reveals TNFRSF13B as a susceptibility gene for intracranial aneurysm: a preliminary study.
16007087 2005 Mutations in TNFRSF13B encoding TACI are associated with common variable immunodeficiency in humans.
16007086 2005 TACI is mutant in common variable immunodeficiency and IgA deficiency.
15827134 2005 The level of TACI gene expression in myeloma cells is associated with a signature of microenvironment dependence versus a plasmablastic signature.
15542592 2005 Structures of APRIL-receptor complexes: like BCMA, TACI employs only a single cysteine-rich domain for high affinity ligand binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14512299 2004 Expression of BCMA, TACI, and BAFF-R in multiple myeloma: a mechanism for growth and survival.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10973284 2000 APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity.
10956646 2000 Tumor necrosis factor (TNF) receptor superfamily member TACI is a high affinity receptor for TNF family members APRIL and BLyS.
10920230 2000 Molecular cloning and functional characterization of murine transmembrane activator and CAML interactor (TACI) with chromosomal localization in human and mouse.
10898980 2000 Interaction of the TNF homologues BLyS and APRIL with the TNF receptor homologues BCMA and TACI.
10881172 2000 Identification of a receptor for BLyS demonstrates a crucial role in humoral immunity.
10880535 2000 TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation.
10801128 2000 TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease.
9311921 1997 NF-AT activation induced by a CAML-interacting member of the tumor necrosis factor receptor superfamily.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.