Property Summary

NCBI Gene PubMed Count 89
PubMed Score 142.56
PubTator Score 108.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Protein-protein Interaction (4)

Gene RIF (80)

PMID Text
26625141 Activated Fn14 expression increases extracellular matrix synthesis and fibroblast activation. Activation of Fn14 is done by the TGF-beta signaling pathway through the transcription factor SMAD4.
26592249 Fn14 has multiple roles in tumor metastasis. (Review)
26497551 Results indicate that FN14 and GRP94 are prediction/prognosis markers which open up new possibilities for preventing/treating brain metastasis in breast cancer patients.
26446946 Evidence that higher tumor Fn14 expression is required for pharmacodynamic response to the anti-TWEAK monoclonal antibody RG7212 in patients with Fn14-positive solid tumors.
26224570 TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages.
26016896 HPV type 16 infections keratinocytes turns from apoptosis to proliferation cycle under FN14 protein influence.
25539934 The first human data to show a transient activation of the TWEAK-Fn14 axis.
25392346 Results indicate that oncogenic Src may contribute to Fn14 overexpression in solid tumors, and that Src mediated cell invasion could potentially be inhibited with Fn14- targeted therapeutics.
25375638 TweakR protein was expressed in about half of human breast cancer samples
25054270 Fn14 modulates cell growth and drug resistance by upregulating Bcl-xl expression through the NF-kappaB pathway.
24970477 results define one upstream mechanism, via FN14 signaling, through which the NFkappaB pathway contributes to prostate cancer metastasis.
24710956 Receptor-targeted therapeutics for both MET and FN14 are in clinical development, the use of which may mitigate the metastatic potential of NSCLC.
24652288 a model in which constitutive down-regulation of Fn14 facilitates dynamic regulation of Fn14 protein levels and prevents spontaneous or inappropriate receptor signaling.
24469836 Results position TWEAK-Fn14 signaling through Mcl-1 as a significant mechanism for NSCLC tumor cell survival
24467773 TWEAK-Fn14 axis may be involved in the pathogenesis of polymyositis and dermatomyositis
24408972 We found that the TNF-like weak inducer of apoptosis (TWEAK)/fibroblast growth factor inducible-14 (Fn14) pathway is involved in the development of pathologic retinal neovascularization.
24337061 High FN14 expression is associated with resistance to 5-fluorouracil in gastric cancer.
24122208 These new findings of the effect of Fn14 on valvular interstitial cell-like differentiation may provide a novel therapeutic strategy for heart valve disease treatment.
24056367 results validate the TWEAK-Fn14 interaction as a chemically tractable target and provide the foundation for further exploration utilizing chemical biology approaches focusing on validating this system as a therapeutic target in invasive cancers.
23999007 Increased podocyte Fn14 expression is associated with proteinuric kidney disease.
23968277 abundantly expressed in the dermal vessel wall of lesional skin in patients with urticarial vasculitis but not controls
23886137 Fn14 overexpression is associated with hepatocellular carcinoma.
23775076 Data indicate that the Src homology 3 domain-containing GEF (SGEF) promotes fibroblast growth factor-inducible 14 (Fn14) proinvasive signaling in glioblastoma via TNF receptor-associated factor 2 (TRAF2).
23750247 insight into the Fn14 signaling mechanism
23722548 Induced overexpression of Fn14 levels in MCF7 cells through HER2 (ERBB2) signaling translated to an improved therapeutic index of hSGZ treatment.
23469193 TWEAK/Fn14, by activating macrophages, could be ovarian tumor suppressors.
23443741 The expression of TWEAK and Fn14 in neuroblastoma suggests that TWEAK functions as an important regulator of primary neuroblastoma growth, invasion and survival.
23438059 TWEAK binds to hFn14 by surface plasmon resonance (View interaction) xeFn14 binds to TWEAK by enzyme linked immunosorbent assay
23320797 The Fn14/TWEAK pathway contributes to the endothelial steps of neuroinflammation.
23300011 Fn14 protein may have a role in breast carcinoma progression
23288170 TWEAK/Fn14 can regulate expression and secretion of HMGB1 in monocytes/macrophages, participating in the inflammatory response associated with atherosclerotic plaque development.
23107828 we show that TWEAK/Fn14 can signal through the JAK-STAT pathway to induce interferon-beta, and that the ability of TWEAK to induce tumor cell apoptosis is mediated by JAK-STAT signaling.
22896023 Glomerular Fn14 and tubulointerstitial TWEAK and IP-10 expression appeared to have consistent changes in relation to the histological class of lupus nephritis and correlated with the histological activity index.
22767506 LCN2 and TWEAKR-TWEAK as crucial downstream effectors of NFAT1 that regulate breast cancer cell motility and invasive capacity.
22672874 This review describes an emerging role of the TWEAK/Fn14 pathway in autoimmune and inflammatory diseases, with a particular focus on inflammatory bowel diseases.
22637703 Fn14, the receptor for TNF-like weak inducer of apoptosis, is selectively upregulated in patients with Alcoholic Hepatitis.
22634180 Elevated expression of Fn14 in non-small cell lung cancer correlates with activated EGFR and promotes tumor cell migration and invasion.
22521346 RAR is able to interact with cytoplasmic AFP and binds to the element of the regulatory region of the Fn14 gene in the neoplastic tissue of human hepatocellular carcinoma patients
22081603 binding of TWEAK to Fn14
22055894 The effect of interaction between TWEAK and its receptor fibroblast growth factor-inducible-14 (Fn14) on cytokine expression in RAFLS.
21993017 effect of Fn14 on cell growth was mediated by the NF-kappaB activity and eventually by the transcriptional regulation of the anti-apoptotic Bcl-2 family gene
21828059 Overexpression of Fn14 promotes androgen-independent prostate cancer progression through MMP-9.
21708117 GRP94, FN14, and inhibin have roles in brain and non-brain metastases in ErbB-2+ and ErbB-2- breast neoplasms
21483105 This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma.
21435232 TWEAK/Fn14 signalling is important in the pathogenesis of inflammation and bone erosion in rheumatoid arthritis.
21303425 Suggest that the renal TWEAK/Fn14 and IP-10/CXCR3 axis may contribute to the pathogenesis of lupus nephritis.
21153335 REVIEW: TWEAK/Fn14 pathway in tissue remodeling
20927042 Fn14 expression was highly upregulated in ischemic renal tissues and tubular epithelial cells of biopsies
20844036 Regulation of TWEAKR expression by Kaposi's sarcoma-associated herpesvirus microRNA prevents TWEAK-induced apoptosis and inflammatory cytokine expression.
20810696 the TWEAK-Fn14 axis can regulate activation of TF and PAI-1 expression in vascular cells
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20610643 Oligomerization of soluble TWEAK differentially affects Fn14-mediated activation of the classical and nonclassical NF-kappa B pathway.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20557950 The transgenic Fn14/TWEAK receptor pathway in a mouse model is adversely involved in inflammatory and ischemic brain disease associated with the strongest increase of endogenous neuroprotective G-CSF and the G-CSF receptor system.
20487651 TWEAKR/Fn14 was expressed on the cell membrane and in the cytoplasm of Rheumatoid arthritis fibroblast-like synoviocytes
20237496 Observational study of gene-disease association. (HuGE Navigator)
20189297 Fn14 expression is high in endometrial cancers and promotes apoptosis of these cancer cells.
20004376 TWEAK/FN-14 might regulate the effects of interleukin 18 adn 15 in the human endometrium.
19963275 These data reveal the TWEAK/Fn14 pathway for regulation of microbial-induced inflammation in the female reproductive tract.
19895311 Tumor necrosis factor-like weak inducer of apoptosis (TWEAK)/fibroblast growth factor-inducible 14 interaction may have proinflammatory effects in retinal pigment epithelial cells. TWEAK increased the production of IL-8 and MCP-1 via Fn14.
19828625 Fn14 (TWEAK receptor) is a novel potential mediator of adipogenesis that is expressed differentially in immature-appearing and mature adipocytes and in benign and malignant adipose tissue-derived tumors.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19349318 Human cardiomyocytes express the TWEAK receptor Fn14. TWEAK/Fn14 may be important in regulating myocardial structural remodeling and function and may play a role in the pathogenesis of dilated cardiomyopathy.
19241374 determination of the solution structure of the Fn14 cysteine-rich domain (CRD)(Glu28-Ala70) by heteronuclear NMR
19018248 Taken together, these findings indicate that the TWEAK/Fn14 pathway contributes to inflammation and tissue injury and is, therefore, a potential therapeutic target in MS.
18505918 Fn14-mediated NF-kappaB pathway activation has a role in in breast tumor invasion and metastasis
17594693 Fn14 protein expression increased with disease progression in esophageal adenocarcinoma
17383968 Fn14 receptor is required for the expression of myogenic regulatory factors and differentiation of myoblasts into myotubes.
17124496 These results indicate that the TWEAK/Fn14 pathway is a novel regulator of skeletal muscle precursor cells and illustrate an important mechanism by which inflammatory cytokines influence tissue regeneration and repair.
17018610 The Fn14 promoter has NF-kappaB binding sites mediating positive feedback causing sustained overexpression of Fn14 & enduring glioma cell invasion. The Fn14 cascade operates as a positive feedback mechanism for elevated & sustained Fn14 expression.
16809572 TWEAK and Fn14 are expressed in atherosclerotic plaques and could be novel mediators of atherosclerosis.
16526941 the TWEAK-Fn14 interaction is highly dependent on multiple Fn14 residues located in both CRD modules
16503147 Expression of Fn14 in subcutaneous adipose tissue from obese patients.
15611130 Fn14 protein functions, in part, through the NFkappaB signaling pathway to up-regulate BCL-XL and BCL-W expression to foster malignant glioblastoma cell survival.
15353286 TWEAK/TWEAK receptor interactions have roles in the pathogenesis of inflammatory and systemic autoimmune diseases [review]
15140220 TWEAK acts on human keratinocytes as an inducer of RANTES via Fn14.
12651623 up-regulated in migrating glioma cells in vitro and overexpressed in advanced glial tumors
12496418 FN14 is the sole mediator of the multiple pathways of TWEAK-induced cell death in all TWEAK-sensitive tumor cell lines.
12445828 These results indicated that TWEAK could induce pro-inflammatory reactions via fibroblast growth factor-inducible 14 (Fn14)on human umbilical vein endothelial cells.

AA Sequence

MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAA      1 - 70
PPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ                71 - 129
//

Text Mined References (89)

PMID Year Title
26625141 2015 Fn14, a Downstream Target of the TGF-? Signaling Pathway, Regulates Fibroblast Activation.
26592249 2015 Fibroblast Growth Factor-Inducible 14: Multiple Roles in Tumor Metastasis.
26497551 2015 FN14 and GRP94 expression are prognostic/predictive biomarkers of brain metastasis outcome that open up new therapeutic strategies.
26446946 2016 Exposure and Tumor Fn14 Expression as Determinants of Pharmacodynamics of the Anti-TWEAK Monoclonal Antibody RG7212 in Patients with Fn14-Positive Solid Tumors.
26224570 2015 TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages.
26016896 2015 HPV Type 16 Infection Switches Keratinocytes from Apoptotic to Proliferative Fate under TWEAK/Fn14 Interaction.
25539934 2015 TWEAK-Fn14 pathway activation after exercise in human skeletal muscle: insights from two exercise modes and a time course investigation.
25416956 2014 A proteome-scale map of the human interactome network.
25392346 2015 The TWEAK Receptor Fn14 Is an Src-Inducible Protein and a Positive Regulator of Src-Driven Cell Invasion.
25375638 2014 Predictive gene signature of response to the anti-TweakR mAb PDL192 in patient-derived breast cancer xenografts.
25054270 2014 Fibroblast growth factor-inducible 14 regulates cell growth and multidrug resistance of small-cell lung cancer through the nuclear factor-?B pathway.
24970477 2014 AR-regulated TWEAK-FN14 pathway promotes prostate cancer bone metastasis.
24710956 2014 FN14 expression correlates with MET in NSCLC and promotes MET-driven cell invasion.
24652288 2014 Regulation of fibroblast growth factor-inducible 14 (Fn14) expression levels via ligand-independent lysosomal degradation.
24469836 2014 Mcl-1 mediates TWEAK/Fn14-induced non-small cell lung cancer survival and therapeutic response.
24467773 2014 Expression of tumor necrosis factor-like weak inducer of apoptosis and fibroblast growth factor-inducible 14 in patients with polymyositis and dermatomyositis.
24408972 2014 TWEAK/Fn14 pathway is a novel mediator of retinal neovascularization.
24337061 2014 TWEAK/Fn14 signaling mediates gastric cancer cell resistance to 5-fluorouracil via NF-?B activation.
24122208 2014 Fn14 promotes differentiation of human mesenchymal stem cells into heart valvular interstitial cells by phenotypic characterization.
24056367 2013 Structural basis and targeting of the interaction between fibroblast growth factor-inducible 14 and tumor necrosis factor-like weak inducer of apoptosis.
23999007 2013 Fn14 in podocytes and proteinuric kidney disease.
23968277 2013 Tumor necrosis factor-like weak inducer of apoptosis and its receptor fibroblast growth factor-inducible 14 are expressed in urticarial vasculitis.
23886137 2013 Roles of fibroblast growth factor-inducible 14 in hepatocellular carcinoma.
23775076 2013 The Src homology 3 domain-containing guanine nucleotide exchange factor is overexpressed in high-grade gliomas and promotes tumor necrosis factor-like weak inducer of apoptosis-fibroblast growth factor-inducible 14-induced cell migration and invasion via tumor necrosis factor receptor-associated factor 2.
23750247 2013 TWEAK-independent Fn14 self-association and NF-?B activation is mediated by the C-terminal region of the Fn14 cytoplasmic domain.
23722548 2013 Antitumor activity of a humanized, bivalent immunotoxin targeting fn14-positive solid tumors.
23469193 2013 Functional expression of TWEAK and the receptor Fn14 in human malignant ovarian tumors: possible implication for ovarian tumor intervention.
23443741 2013 Expression of TWEAK/Fn14 in neuroblastoma: implications in tumorigenesis.
23438059 2013 Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions.
23320797 2013 TWEAK/Fn14 pathway modulates properties of a human microvascular endothelial cell model of blood brain barrier.
23300011 2013 Clinical correlations and prognostic relevance of Fn14 expression in breast carcinoma.
23288170 2013 HMGB1 expression and secretion are increased via TWEAK-Fn14 interaction in atherosclerotic plaques and cultured monocytes.
23107828 2013 TWEAK signals through JAK-STAT to induce tumor cell apoptosis.
22896023 2012 Relationship of intrarenal gene expression and the histological class of lupus nephritis -- a study on repeat renal biopsy.
22767506 2012 Lipocalin 2, the TNF-like receptor TWEAKR and its ligand TWEAK act downstream of NFAT1 to regulate breast cancer cell invasion.
22672874 2012 The TWEAK/Fn14 pathway as an aggravating and perpetuating factor in inflammatory diseases: focus on inflammatory bowel diseases.
22637703 2013 Transcriptome analysis identifies TNF superfamily receptors as potential therapeutic targets in alcoholic hepatitis.
22634180 2012 Elevated expression of Fn14 in non-small cell lung cancer correlates with activated EGFR and promotes tumor cell migration and invasion.
22521346 2012 Alpha-fetoprotein acts as a novel signal molecule and mediates transcription of Fn14 in human hepatocellular carcinoma.
22081603 2012 Studies of binding of tumor necrosis factor (TNF)-like weak inducer of apoptosis (TWEAK) to fibroblast growth factor inducible 14 (Fn14).
22055894 2012 Inhibition of TNF-induced IL-6 by the TWEAK-Fn14 interaction in rheumatoid arthritis fibroblast like synoviocytes.
21993017 2012 Elevated fibroblast growth factor-inducible 14 expression promotes gastric cancer growth via nuclear factor-?B and is associated with poor patient outcome.
21828059 2011 Overexpression of Fn14 promotes androgen-independent prostate cancer progression through MMP-9 and correlates with poor treatment outcome.
21708117 2011 Expression of endoplasmic reticulum stress proteins is a candidate marker of brain metastasis in both ErbB-2+ and ErbB-2- primary breast tumors.
21525013 2011 TWEAK induces apoptosis through a death-signaling complex comprising receptor-interacting protein 1 (RIP1), Fas-associated death domain (FADD), and caspase-8.
21483105 2011 Detection of the TNFSF members BAFF, APRIL, TWEAK and their receptors in normal kidney and renal cell carcinomas.
21435232 2011 TWEAK and Fn14 expression in the pathogenesis of joint inflammation and bone erosion in rheumatoid arthritis.
21303425 2011 Gene expression of TWEAK/Fn14 and IP-10/CXCR3 in glomerulus and tubulointerstitium of patients with lupus nephritis.
21153335 2011 The TWEAK/Fn14 pathway in tissue remodeling: for better or for worse.
20927042 2011 Direct targeting of fibroblast growth factor-inducible 14 protein protects against renal ischemia reperfusion injury.
20844036 2010 Regulation of tumor necrosis factor-like weak inducer of apoptosis receptor protein (TWEAKR) expression by Kaposi's sarcoma-associated herpesvirus microRNA prevents TWEAK-induced apoptosis and inflammatory cytokine expression.
20810696 2011 TWEAK-Fn14 interaction enhances plasminogen activator inhibitor 1 and tissue factor expression in atherosclerotic plaques and in cultured vascular smooth muscle cells.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20610643 2010 Soluble and transmembrane TNF-like weak inducer of apoptosis differentially activate the classical and noncanonical NF-kappa B pathway.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20557950 2010 Neuroprotective effect of Fn14 deficiency is associated with induction of the granulocyte-colony stimulating factor (G-CSF) pathway in experimental stroke and enhanced by a pathogenic human antiphospholipid antibody.
20487651 2010 [The expression of TWEAKR/Fn14 in Rheumatoid arthritis fibroblast-like synoviocytes].
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20189297 2010 TWEAK/Fn14 promotes apoptosis of human endometrial cancer cells via caspase pathway.
20004376 2010 Tumor necrosis factor-like weak inducer of apoptosis (TWEAK)/fibroblast growth factor inducible-14 might regulate the effects of interleukin 18 and 15 in the human endometrium.
19963275 2010 Fibroblast growth factor-inducible 14 (Fn14) is expressed in the lower genital tract and may play a role in amplifying inflammation during infection.
19895311 2009 Proinflammatory effect of TWEAK/Fn14 interaction in human retinal pigment epithelial cells.
19828625 2009 Adipocytes as immune cells: differential expression of TWEAK, BAFF, and APRIL and their receptors (Fn14, BAFF-R, TACI, and BCMA) at different stages of normal and pathological adipose tissue development.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19349318 2009 A novel role for tumor necrosis factor-like weak inducer of apoptosis (TWEAK) in the development of cardiac dysfunction and failure.
19241374 2009 Solution structure of the cysteine-rich domain in Fn14, a member of the tumor necrosis factor receptor superfamily.
19018248 2008 Expression of TWEAK and its receptor Fn14 in the multiple sclerosis brain: implications for inflammatory tissue injury.
18505918 2008 The fibroblast growth factor-inducible 14 receptor is highly expressed in HER2-positive breast tumors and regulates breast cancer cell invasive capacity.
17594693 2007 Identification of Fn14/TWEAK receptor as a potential therapeutic target in esophageal adenocarcinoma.
17383968 2007 Fibroblast growth factor inducible 14 (Fn14) is required for the expression of myogenic regulatory factors and differentiation of myoblasts into myotubes. Evidence for TWEAK-independent functions of Fn14 during myogenesis.
17124496 2006 TWEAK, via its receptor Fn14, is a novel regulator of mesenchymal progenitor cells and skeletal muscle regeneration.
17018610 2006 Increased fibroblast growth factor-inducible 14 expression levels promote glioma cell invasion via Rac1 and nuclear factor-kappaB and correlate with poor patient outcome.
16809572 2006 Fn14 is upregulated in cytokine-stimulated vascular smooth muscle cells and is expressed in human carotid atherosclerotic plaques: modulation by atorvastatin.
16526941 2006 TWEAK binding to the Fn14 cysteine-rich domain depends on charged residues located in both the A1 and D2 modules.
16503147 2006 Expression of TWEAK and its receptor Fn14 in human subcutaneous adipose tissue. Relationship with other inflammatory cytokines in obesity.
16341674 2005 Transcriptome analysis of human gastric cancer.
15611130 2005 The tumor necrosis factor-like weak inducer of apoptosis (TWEAK)-fibroblast growth factor-inducible 14 (Fn14) signaling system regulates glioma cell survival via NFkappaB pathway activation and BCL-XL/BCL-W expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353286 2004 The role of TWEAK/Fn14 in the pathogenesis of inflammation and systemic autoimmunity.
15140220 2004 Induction of RANTES by TWEAK/Fn14 interaction in human keratinocytes.
14573547 2003 Fibroblast growth factor-inducible-14 is induced in axotomized neurons and promotes neurite outgrowth.
12651623 2003 The human Fn14 receptor gene is up-regulated in migrating glioma cells in vitro and overexpressed in advanced glial tumors.
12496418 2003 Fibroblast growth factor-inducible 14 mediates multiple pathways of TWEAK-induced cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445828 2002 Pro-inflammatory effect of TWEAK/Fn14 interaction on human umbilical vein endothelial cells.
11728344 2001 A novel TNF receptor family member binds TWEAK and is implicated in angiogenesis.
10751351 2000 The Fn14 immediate-early response gene is induced during liver regeneration and highly expressed in both human and murine hepatocellular carcinomas.
10551889 1999 The mitogen-inducible Fn14 gene encodes a type I transmembrane protein that modulates fibroblast adhesion and migration.