Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.36
PubTator Score 5.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1296 4.7e-05
ovarian cancer 8297 4.9e-05
Disease Target Count Z-score Confidence
Trichinosis 7 3.465 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.614 4.7e-05
ovarian cancer 1.600 4.9e-05

Gene RIF (2)

AA Sequence

MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCDFDWREVEILM      1 - 70
FLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLCIVFLMTCKPPLYMGPEYIKY     71 - 140
FNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVST    141 - 210
SPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPV    211 - 280
ASTPTTVSDGENKKDK                                                          281 - 296
//

Text Mined References (18)

PMID Year Title