Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.35
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.900 1.7e-02
astrocytic glioma 1.200 4.2e-02
osteosarcoma 4.434 2.6e-05
group 4 medulloblastoma 2.700 9.5e-05
atypical teratoid / rhabdoid tumor 1.700 1.1e-02
glioblastoma 1.300 4.9e-03
tuberculosis 1.900 4.1e-07
intraductal papillary-mucinous adenoma (... 1.800 2.9e-04
intraductal papillary-mucinous carcinoma... 1.600 1.2e-03
intraductal papillary-mucinous neoplasm ... 2.100 2.8e-03
active Crohn's disease 1.224 2.0e-02
interstitial cystitis -1.200 3.4e-04
adult high grade glioma 1.400 2.1e-02
Endometriosis -1.034 1.9e-02
lung carcinoma -2.100 2.6e-33
Pick disease -1.200 2.2e-03
progressive supranuclear palsy -1.700 6.6e-03
ovarian cancer -1.600 7.7e-07

Gene RIF (6)

PMID Text
24764305 findings provide an important link between aneuploidy and the stress pathways activated by Aurora B inhibition and also support the use of Aurora B inhibitors in combination therapy for treatment of cancer.
23333304 HIV-1 Vif upregulates the expression of transmembrane and tetratricopeptide repeat containing 2 (TMTC2) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19386601 TMTC2 expression induced by HIF-2alpha.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MIAELVSSALGLALYLNTLSADFCYDDSRAIKTNQDLLPETPWTHIFYNDFWGTLLTHSGSHKSYRPLCT      1 - 70
LSFRLNHAIGGLNPWSYHLVNVLLHAAVTGLFTSFSKILLGDGYWTFMAGLMFASHPIHTEAVAGIVGRA     71 - 140
DVGASLFFLLSLLCYIKHCSTRGYSARTWGWFLGSGLCAGCSMLWKEQGVTVLAVSAVYDVFVFHRLKIK    141 - 210
QILPTIYKRKNLSLFLSISLLIFWGSSLLGARLYWMGNKPPSFSNSDNPAADSDSLLTRTLTFFYLPTKN    211 - 280
LWLLLCPDTLSFDWSMDAVPLLKTVCDWRNLHTVAFYTGLLLLAYYGLKSPSVDRECNGKTVTNGKQNAN    281 - 350
GHSCLSDVEYQNSETKSSFASKVENGIKNDVSQRTQLPSTENIVVLSLSLLIIPFVPATNLFFYVGFVIA    351 - 420
ERVLYIPSMGFCLLITVGARALYVKVQKRFLKSLIFYATATLIVFYGLKTAIRNGDWQNEEMLYRSGIKV    421 - 490
NPAKAWGNLGNVLKSQSKISEAESAYRNALYYRSNMADMLYNLGLLLQENSRFAEALHYYKLAIGSRPTL    491 - 560
ASAYLNTGIILMNQGRTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLGKLYHEQGHYEEALSVYK    561 - 630
EAIQKMPRQFAPQSLYNMMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLF    631 - 700
LKAIELDPTKGNCYMHYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDL    701 - 770
AARLRPNYPAALMNLGAILHLNGRLQKAEANYLRALQLKPDDVITQSNLRKLWNIMEKQGLKTSKT        771 - 836
//

Text Mined References (18)

PMID Year Title
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24764305 2014 TMTC1 and TMTC2 are novel endoplasmic reticulum tetratricopeptide repeat-containing adapter proteins involved in calcium homeostasis.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19625618 2009 Three susceptible loci associated with primary open-angle glaucoma identified by genome-wide association study in a Japanese population.
19386601 2009 Genome-wide association of hypoxia-inducible factor (HIF)-1alpha and HIF-2alpha DNA binding with expression profiling of hypoxia-inducible transcripts.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.