Property Summary

NCBI Gene PubMed Count 7
PubMed Score 17.33
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS                               1 - 45
//

Text Mined References (7)

PMID Year Title