Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.01
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAGAGVGSWLLVL      1 - 70
YLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWS     71 - 140
PALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECG    141 - 210
ARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSH    211 - 280
SAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHT    281 - 350
HPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLV    351 - 420
GVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQDSLL                                     421 - 457
//