Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.63
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.257 6.6e-04
osteosarcoma 1.395 9.7e-04
medulloblastoma, large-cell -1.500 1.6e-04
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-02
pilocytic astrocytoma 1.200 4.2e-04
posterior fossa group B ependymoma 1.200 3.6e-05
sonic hedgehog group medulloblastoma -1.100 7.6e-05
lung adenocarcinoma -1.600 1.2e-16
ovarian cancer -1.800 1.2e-09

Gene RIF (1)

PMID Text
20951001 transmembrane protein 9B was identified as a putative antigenic target in Wegener's granulomatosis

AA Sequence

MATLWGGLLRLGSLLSLSCLALSVLLLAQLSDAAKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLH      1 - 70
VVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLI     71 - 140
QSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS                141 - 198
//

Text Mined References (14)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20951001 2011 Wegener's granuloma harbors B lymphocytes with specificities against a proinflammatory transmembrane protein and a tetraspanin.
18541524 2008 The lysosomal transmembrane protein 9B regulates the activity of inflammatory signaling pathways.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528127 2001 Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7.