Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.40
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.700 1.4e-03
atypical teratoid / rhabdoid tumor -2.000 1.8e-06
pediatric high grade glioma -1.500 7.3e-04
pilocytic astrocytoma -1.900 1.0e-07
posterior fossa group B ependymoma 2.300 4.4e-09
subependymal giant cell astrocytoma -1.722 5.6e-03

Gene RIF (1)

PMID Text
18294959 These findings demonstrate that TMEM74 may be involved in promoting functional autophagy during cell starvation and other stress conditions.

AA Sequence

MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSS      1 - 70
LQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELG     71 - 140
WENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVTGILLVIISYIVPREVTVDPNTVA    141 - 210
AREMERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNF    211 - 280
RMKTSTNENTLELSLVEEDALAVQS                                                 281 - 305
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19029833 2009 High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.
18294959 2008 TMEM74, a lysosome and autophagosome protein, regulates autophagy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.