Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.800 4.6e-04
aldosterone-producing adenoma -1.215 2.0e-02
Amyotrophic lateral sclerosis 1.026 2.2e-04
astrocytic glioma -2.100 3.7e-02
Astrocytoma, Pilocytic -1.500 5.6e-03
Atopic dermatitis -1.600 3.8e-02
atypical teratoid / rhabdoid tumor -1.800 1.6e-05
cystic fibrosis -1.700 1.3e-04
ductal carcinoma in situ -1.500 4.9e-02
ependymoma -1.900 2.0e-02
glioblastoma -1.700 1.3e-05
group 3 medulloblastoma -2.700 7.2e-05
interstitial cystitis -1.500 1.3e-03
invasive ductal carcinoma -1.800 1.8e-02
medulloblastoma, large-cell -3.300 2.2e-07
oligodendroglioma -2.000 1.4e-02
osteosarcoma -3.712 4.8e-06
ovarian cancer -1.100 5.7e-03
pancreatic ductal adenocarcinoma liver m... -2.819 3.0e-03
Pneumonia 1.100 1.9e-02
primitive neuroectodermal tumor -2.900 2.0e-05
psoriasis -2.000 3.0e-16
subependymal giant cell astrocytoma -1.776 1.9e-02
ulcerative colitis -2.200 1.3e-05
urothelial carcinoma -1.900 1.9e-02

Gene RIF (1)

AA Sequence

MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHSLVVGIFGLYIF      1 - 70
LFDEATKADPLWGGPSLANVNIAIASGYLISDLSIIILYWKVIGDKFFIMHHCASLYAYYLVLKNGVLAY     71 - 140
IGNFRLLAELSSPFVNQRWFFEALKYPKFSKAIVINGILMTVVFFIVRIASMLPHYGFMYSVYGTEPYIR    141 - 210
LGVLIQLSWVISCVVLDVMNVMWMIKISKGCIKVISHIRQEKAKNSLQNGKLD                     211 - 263
//

Text Mined References (7)

PMID Year Title