Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54
PubTator Score 0.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.900 1.9e-02
astrocytic glioma -2.100 3.7e-02
ependymoma -2.600 1.5e-02
oligodendroglioma -2.600 2.0e-02
glioblastoma -3.900 1.0e-05
osteosarcoma -5.291 1.0e-08
medulloblastoma -4.200 2.1e-09
atypical teratoid / rhabdoid tumor -3.600 5.1e-08
medulloblastoma, large-cell -5.300 1.1e-06
primitive neuroectodermal tumor -3.400 1.5e-04
Amyotrophic Lateral Sclerosis 1.282 4.0e-07
Atopic dermatitis -1.600 3.8e-02
pancreatic ductal adenocarcinoma liver m... -2.819 3.0e-03
interstitial cystitis -1.500 1.3e-03
cystic fibrosis -1.700 1.3e-04
pediatric high grade glioma -3.300 9.6e-06
pilocytic astrocytoma -1.500 5.8e-03
aldosterone-producing adenoma -1.215 2.0e-02
psoriasis -2.300 2.0e-34
Pneumonia 1.100 1.9e-02
subependymal giant cell astrocytoma -2.810 3.4e-03
ductal carcinoma in situ -1.500 4.9e-02
invasive ductal carcinoma -1.800 1.8e-02
ulcerative colitis -2.300 1.1e-06
ovarian cancer -1.100 5.7e-03

Synonym

Accession Q96MV1 B2RPI2 D3DT48
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEINTKLLISVTCISFFTFQLLFYFVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHSLVVGIFGLYIF      1 - 70
LFDEATKADPLWGGPSLANVNIAIASGYLISDLSIIILYWKVIGDKFFIMHHCASLYAYYLVLKNGVLAY     71 - 140
IGNFRLLAELSSPFVNQRWFFEALKYPKFSKAIVINGILMTVVFFIVRIASMLPHYGFMYSVYGTEPYIR    141 - 210
LGVLIQLSWVISCVVLDVMNVMWMIKISKGCIKVISHIRQEKAKNSLQNGKLD                     211 - 263
//

Text Mined References (7)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.