Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.96
PubTator Score 0.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Down syndrome 1.400 1.9e-04
Waldenstrons macroglobulinemia 1.308 2.7e-02
Multiple myeloma 1.803 4.0e-03
malignant mesothelioma -1.100 1.3e-05
osteosarcoma -2.515 1.1e-09
medulloblastoma, large-cell -1.900 2.1e-04
non-small cell lung cancer -1.080 1.4e-16
intraductal papillary-mucinous neoplasm ... 1.300 2.3e-02
active Crohn's disease 1.395 6.3e-03
active ulcerative colitis 1.088 1.2e-02
sonic hedgehog group medulloblastoma -1.100 3.1e-04
Pick disease -1.200 1.5e-05
ovarian cancer -1.700 8.3e-07

Synonym

Accession P56557 B2R4L4 D3DSF1 O60537 Q5PY47
Symbols C21orf4
HCVP7TP3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFF      1 - 70
MINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNAL     71 - 140
IFFSTLIYKFGRTEELWT                                                        141 - 158
//

Text Mined References (15)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10830953 2000 The DNA sequence of human chromosome 21.
10077530 1999 Comparative genomic analysis of the interferon/interleukin-10 receptor gene cluster.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.