Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.49
PubTator Score 4.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Crohn's disease -1.049 3.6e-02
acute myeloid leukemia -2.100 4.0e-02
Astrocytoma, Pilocytic -1.200 1.1e-02
atypical teratoid / rhabdoid tumor -1.800 3.2e-02
Breast cancer -2.500 4.8e-09
breast carcinoma -1.200 8.3e-06
Down syndrome 1.400 2.2e-03
ductal carcinoma in situ -1.800 6.4e-04
ependymoma 2.200 1.7e-02
glioblastoma -1.400 2.2e-02
group 3 medulloblastoma -1.700 7.1e-03
hereditary spastic paraplegia -1.145 1.4e-02
intraductal papillary-mucinous adenoma (... -1.700 3.8e-04
intraductal papillary-mucinous carcinoma... -1.700 1.3e-03
invasive ductal carcinoma -2.300 4.1e-04
lung adenocarcinoma -1.800 6.4e-13
lung cancer -1.700 3.2e-03
malignant mesothelioma -5.900 3.0e-09
medulloblastoma, large-cell -2.200 2.4e-02
nephrosclerosis 1.279 1.7e-03
non-small cell lung cancer -1.577 1.9e-12
osteosarcoma 2.527 8.0e-03
ovarian cancer -1.500 4.5e-05
pancreatic cancer 1.200 1.7e-02
Pick disease 1.700 7.3e-06
pituitary cancer -1.100 1.6e-02
primary pancreatic ductal adenocarcinoma 1.161 1.6e-02
psoriasis -1.400 4.4e-05
ulcerative colitis 1.400 3.2e-03

Synonym

Accession Q9BQJ4 Q5JR44
Symbols BCMP1
VAB-9
TM4SF10

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRKPASLDIWHCE      1 - 70
STLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAAVVLQVCSLVLYPIKFIET     71 - 140
VSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY                                 141 - 181
//

Text Mined References (18)

PMID Year Title