Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.700 9.1e-03
ependymoma -2.900 2.8e-02
glioblastoma multiforme -2.100 3.9e-17
oligodendroglioma -1.100 2.0e-07
cystic fibrosis 1.204 8.9e-04
atypical teratoid / rhabdoid tumor -2.500 3.1e-03
medulloblastoma, large-cell -3.900 2.3e-04
colon cancer -2.700 2.0e-09
adult high grade glioma -2.200 9.1e-05
Pick disease -1.200 3.2e-02
ductal carcinoma in situ -1.600 2.0e-03
invasive ductal carcinoma -2.000 3.2e-03
pituitary cancer 2.900 2.2e-06
psoriasis -1.400 2.7e-33

Synonym

Accession Q53FP2 Q9H7Y3
Symbols TMEM35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGA      1 - 70
LEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSS     71 - 140
EKKPLPGNAEEQPSLYEKAPQGKVKVS                                               141 - 167
//

Text Mined References (6)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.