Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 3.5e-02
Astrocytoma, Pilocytic 1.400 1.7e-07
atypical teratoid / rhabdoid tumor 2.200 1.7e-09
colon cancer 2.000 3.0e-02
ependymoma 1.700 9.8e-15
glioblastoma 1.300 1.0e-03
malignant mesothelioma -1.200 1.6e-06
ovarian cancer 1.900 1.1e-05
pediatric high grade glioma 1.600 1.0e-07
primitive neuroectodermal tumor 1.200 1.0e-03
psoriasis 2.300 1.7e-04
sonic hedgehog group medulloblastoma 1.200 4.0e-03

Synonym

Accession Q9H7F4 A8K1G5 Q53T33 Q66K44 Q8IZ77
Symbols FAM11B

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

AA Sequence

MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASVGAGVWARNPR      1 - 70
YRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLFFVSPVSVAACVWGFRHDRSL     71 - 140
ELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTH    141 - 210
VTMAISWITIVVPLLTFEVLLVHRLDGHNTFSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQ    211 - 280
FLLEIFPFLREYGNISYDLHHEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD    281 - 350
//

Text Mined References (7)

PMID Year Title