Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.67
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8297 2.6e-04

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 2.6e-04

Gene RIF (1)

AA Sequence

MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQAS      1 - 70
PEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILV     71 - 140
GVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK                   141 - 195
//

Text Mined References (8)

PMID Year Title