Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.42
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (3)

Gene RIF (3)

AA Sequence

MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK            1 - 64
//

Text Mined References (9)

PMID Year Title