Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.00
PubTator Score 4.38

Knowledge Summary


No data available



  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.225 1.0e-02
osteosarcoma 1.493 8.5e-05
hereditary spastic paraplegia -1.213 9.7e-04
Breast cancer 3.700 2.4e-02
lung adenocarcinoma 1.088 3.5e-05
ovarian cancer 2.100 2.4e-03


Accession Q99805 A8K399 Q2TAY5
Symbols P76


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of transmembrane 9 superfamily member 2 (TM9SF2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD                                         631 - 663

Text Mined References (13)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9729438 1998 Characterization of a 76 kDa endosomal, multispanning membrane protein that is highly conserved throughout evolution.
9230071 1997 A novel Rab9 effector required for endosome-to-TGN transport.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.