Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.67
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group A ependymoma 1.200 3.3e-09
atypical teratoid/rhabdoid tumor 1.400 2.2e-08
group 3 medulloblastoma 1.500 3.6e-05

Pathway (1)

Gene RIF (1)

PMID Text
19029833 The results of transmission electron microscopy and immunoblotting to examine LC3-II levels further confirmed the ability of TM9SF1 to induce autophagy.

AA Sequence

MTVVGNPRSWSCQWLPILILLLGTGHGPGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPE      1 - 70
KIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRG     71 - 140
FVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSE    141 - 210
TSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSG    211 - 280
DDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYA    281 - 350
LTCCISGYVSSHFYRQIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWL    351 - 420
LVGFPLTVIGGIFGKNNASPFDAPCRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVW    421 - 490
GREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNM    491 - 560
SGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD                            561 - 606
//

Text Mined References (6)

PMID Year Title
19029833 2009 High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11595169 2001 The iodocyanopindolol and SM-11044 binding protein belongs to the TM9SF multispanning membrane protein superfamily.
9332367 1997 Cloning of a human multispanning membrane protein cDNA: evidence for a new protein family.