Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.42
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.452 2.0e-02
adult high grade glioma -1.200 5.0e-04
ductal carcinoma in situ -1.200 6.1e-03
esophageal adenocarcinoma -1.300 2.2e-02
interstitial cystitis -1.200 8.0e-04
intraductal papillary-mucinous adenoma (... -1.200 2.2e-03
malignant mesothelioma 2.700 3.8e-07
osteosarcoma -1.844 1.2e-08
pituitary cancer 1.400 6.0e-05
psoriasis 1.400 4.2e-04

Gene RIF (5)

AA Sequence

MAPTQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWL      1 - 70
GLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGMSAGLPLGALPEMLLPLAFVATLT     71 - 140
AFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLM    141 - 210
KEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLH    211 - 280
HPQPLGLPMASVICLINATGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPN    281 - 350
YLGDLIMALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY      351 - 418
//

Text Mined References (13)

PMID Year Title