Property Summary

NCBI Gene PubMed Count 28
PubMed Score 52.39
PubTator Score 47.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (21)

AA Sequence

MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF      1 - 70
EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT     71 - 140
AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV    141 - 210
KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED    211 - 280
SSKVPAVTSLV                                                               281 - 291
//

Text Mined References (28)

PMID Year Title