Property Summary

NCBI Gene PubMed Count 28
PubMed Score 52.39
PubTator Score 47.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Synonym

Accession O43711 Q96AD3
Symbols RNX
HOX11L2

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (21)

AA Sequence

MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF      1 - 70
EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT     71 - 140
AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV    141 - 210
KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED    211 - 280
SSKVPAVTSLV                                                               281 - 291
//

Text Mined References (28)

PMID Year Title