Property Summary

NCBI Gene PubMed Count 28
PubMed Score 51.41
PubTator Score 47.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 1.5e-07
psoriasis 6685 9.7e-03
Disease Target Count Z-score Confidence
acute lymphocytic leukemia 25 5.174 2.6
T-cell leukemia 4 3.156 1.6
Disease Target Count
acute T cell leukemia 17

Synonym

Accession O43711 Q96AD3
Symbols RNX
HOX11L2

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (21)

PMID Text
26852660 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
24997618 Studies suggest that homeobox protein TLX3 expression is not an indicator for the prognosis of pediatric T cell acute lymphocytic leukemia (T-ALL).
24571118 Egyptian T-cell acute lymphoblastic leukemia cases seemed to have a different genetic pattern compared to other populations, with a lower incidence of TLX3/HOX11L2 and SIL/TAL but a higher incidence of NKX2-5 expression than recorded in Western countries
22516263 The cortical thymic maturation arrest in T-lineage Acute lymphoblastic leukemias (ALLs) that overexpress TLX1 or TLX3 is due to binding of TLX1/TLX3 to ETS1.
22366949 these results place TLX1 and TLX3 at the top of an oncogenic transcriptional network controlling leukemia development, and identify RUNX1 as a tumor-suppressor gene in T-ALL
21617853 We found that 22 (21%) out of 110 clinical samples of bladder cancer showed the methylated pattern using the COBRA assay in TLX3. We found a correlation between TLX3 methylation and the sensitivity to cisplatin in the clinical samples by SDI test.
21374761 Results identify Tlx3 as a novel target for canonical Wnt signaling that confers somatic stem cells with a sensory neuron phenotype upon neural induction.
21225930 High TLX3/BCL11B fusion protein expression is associated with T/myeloid acute bilineal leukemia.
18368072 Aberrant HOX11L2 expression is associated with thymic adult T-cell acute lymphoblastic leukemia
18185524 five recurrent genomic deletions in TLX3 rearranged T-ALL; genome-wide overview of copy number changes in TLX3 rearranged T-ALL
17308084 In T-cell acute lymphoblastic leukemia, alternative t(5;14)(q35;q32.2) forms effect dysregulation of either TLX3 or NKX2-5 homeobox genes at 5q35 by juxtaposition with 14q32.2 breakpoints dispersed across the BCL11B downstream genomic desert.
16966433 The present report is focused on the identification of elements and factors playing a role in the TLX3 physiologic expression regulation and therefore likely to be involved in cancer development.
15990867 The Significance of HOX11L2/TLX3 expression in children with T-cell acute lymphoblastic leukemia treated on Children's Cancer Group protocols.
15674415 The TLX3 protein is high levels expressed in the leukemia cells in keeping with the presence of t(5;14)(q35;q14) in leukemia cells.
15334547 TLX3 expression in T-ALL is strongly associated with the presence of genomic rearrangements
15240857 Observational study of gene-disease association. (HuGE Navigator)
14504110 HOX11L2 expression is linked to chromosomes 5 and 14 in T-cell malignancies in children.
12970786 Translocations in Hox11L2 locus is associated with T-cell acute lymphoblastic leukemia
12454747 High incidence of Hox11L2 expression in children with T-ALL
12407709 Authors conclude that RNX, and presumably its expression, are not altered in the index cases of congenital central hypoventilation syndrome.
12130513 HOX11L2 expression defines a clinical subtype of pediatric T-ALL associated with poor prognosis.

AA Sequence

MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF      1 - 70
EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT     71 - 140
AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV    141 - 210
KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED    211 - 280
SSKVPAVTSLV                                                               281 - 291
//

Text Mined References (28)

PMID Year Title
26852660 2016 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
25428367 2014 Prediction of DNA binding motifs from 3D models of transcription factors; identifying TLX3 regulated genes.
24997618 2014 The effect of TLX3 expression on the prognosis of pediatric T cell acute lymphocytic leukemia--a systematic review.
24571118 2016 NKX2-5, SIL/TAL and TLX3/HOX11L2 expression in Egyptian pediatric T-cell acute lymphoblastic leukemia.
22516263 2012 TLX homeodomain oncogenes mediate T cell maturation arrest in T-ALL via interaction with ETS1 and suppression of TCR? gene expression.
22366949 2012 Reverse engineering of TLX oncogenic transcriptional networks identifies RUNX1 as tumor suppressor in T-ALL.
21617853 2011 Aberrant DNA methylation of T-cell leukemia, homeobox 3 modulates cisplatin sensitivity in bladder cancer.
21374761 2011 Wnt signaling promotes neuronal differentiation from mesenchymal stem cells through activation of Tlx3.
21225930 2011 Successful treatment of a child with T/myeloid acute bilineal leukemia associated with TLX3/BCL11B fusion and 9q deletion.
18368072 2008 Thymic adult T-cell acute lymphoblastic leukemia stratified in standard- and high-risk group by aberrant HOX11L2 expression: experience of the German multicenter ALL study group.
18185524 2008 Cooperative genetic defects in TLX3 rearranged pediatric T-ALL.
17308084 2007 Activation of TLX3 and NKX2-5 in t(5;14)(q35;q32) T-cell acute lymphoblastic leukemia by remote 3'-BCL11B enhancers and coregulation by PU.1 and HMGA1.
16966433 2006 Nuclear factor Y drives basal transcription of the human TLX3, a gene overexpressed in T-cell acute lymphocytic leukemia.
15990867 2005 Significance of HOX11L2/TLX3 expression in children with T-cell acute lymphoblastic leukemia treated on Children's Cancer Group protocols.
15674415 2005 NUP214-ABL1 amplification in t(5;14)/HOX11L2-positive ALL present with several forms and may have a prognostic significance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334547 2004 Various types of rearrangements target TLX3 locus in T-cell acute lymphoblastic leukemia.
15240857 2004 Sudden infant death syndrome: case-control frequency differences at genes pertinent to early autonomic nervous system embryologic development.
14504110 2004 Clinical significance of HOX11L2 expression linked to t(5;14)(q35;q32), of HOX11 expression, and of SIL-TAL fusion in childhood T-cell malignancies: results of EORTC studies 58881 and 58951.
12970786 2003 t(5;14)/HOX11L2-positive T-cell acute lymphoblastic leukemia. A collaborative study of the Groupe Français de Cytogénétique Hématologique (GFCH).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454747 2002 High incidence of Hox11L2 expression in children with T-ALL.
12407709 2002 Mutational analysis of the RNX gene in congenital central hypoventilation syndrome.
12130513 2002 HOX11L2 expression defines a clinical subtype of pediatric T-ALL associated with poor prognosis.
11587205 2001 A new recurrent and specific cryptic translocation, t(5;14)(q35;q32), is associated with expression of the Hox11L2 gene in T acute lymphoblastic leukemia.
11435718 2001 Assignment of the human homeobox 11-like 2 gene (HOX11L2) to chromosome 5q34-->q35 by radiation hybrid mapping.
11435716 2001 Assignment of the HOX11L2 gene to human chromosome band 5q35.1 and of its murine homolog to mouse chromosome bands 11A4-A5 by in situ hybridization.
8099440 1993 The HOX11 gene encodes a DNA-binding nuclear transcription factor belonging to a distinct family of homeobox genes.