Property Summary

NCBI Gene PubMed Count 250
PubMed Score 974.19
PubTator Score 545.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Dermatitis, Allergic Contact 66
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.200 1.2e-02
hepatocellular carcinoma 1.800 7.2e-05
pancreatic cancer 1.300 1.4e-02
cutaneous lupus erythematosus 3.800 1.3e-04
osteosarcoma -1.705 3.0e-02
glioblastoma 1.400 2.5e-02
medulloblastoma, large-cell -1.500 2.2e-04
tuberculosis 1.800 3.7e-03
non-small cell lung cancer -1.003 1.1e-08
lung cancer -2.300 1.8e-04
group 3 medulloblastoma -1.100 2.0e-03
pilocytic astrocytoma 1.600 9.6e-07
primary Sjogren syndrome 1.700 2.2e-04
pancreatic carcinoma 1.300 1.4e-02
lung carcinoma -1.400 3.4e-14
ovarian cancer -1.900 4.1e-05

Protein-protein Interaction (4)

Gene RIF (237)

PMID Text
26903634 Data show that differences in codon bias limit Toll-like receptor 7 (TLR7) expression relative to Toll-like receptor 9 (TLR9).
26741133 TLR7 rs179008 showed some associations with post-bronchiolitis lung function deficiency, and polymorphisms of TLR4 rs4986790, and TLR6 rs5743810 in particular, with airway reactivity.
26725554 TLR7 and 8 polymorphisms may play a considerable role in the pathogenesis of asthma.
26723518 Increased expression of TLR7 and TLR9 in myasthenia gravis thymus is accompanied by active Epstein-Barr virus infection.
26718740 activation of TLR7 upregulated the expression levels of IFN-lambda1 and MMP-9 were increased by ~3 fold, whereas other genes (p53, PTEN, TIMP-1) were upregulated by ~2 fold, and VEGF was marginally upregulated after 10 min.
26512111 Conventional dendritic cell expression of TLR7 is essential for severe autoimmunity in the Sle1Tg7 model of systemic lupus erythematosus.
26483222 TLR7 and TLR8 may be involved in the pathogenesis of brain and lung damages caused by severe EV71 infection.
26371257 These results indicated that thiostrepton is a novel TLR7-9 inhibitor
26363072 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via MyD88-TLR7 signaling.
26340429 NADPH oxidase-deficient patient-derived B cells also expressed enhanced levels of TLR7 and TLR9 mRNA and protein compared with the same cells reconstituted to restore oxidase activity.
26315138 Results show that TLR7 and TLR8 on trophoblastic cells play an important role in the prevention of intrauterine HBV transmission by inhibiting HBV translocation across trophoblasts.
26255864 mechanism conversely holds for plasmacytoid DCs that respond to TLR3 ligation when TLR7 pathway is mobilized.
26238718 Activation of TLR7 suppresses the progression of pancreatic cancer.
26198699 Invariant chain is a new chaperone for TLR7 in B cells. (Review)
26134824 Study show a stage-dependent upregulation of both TLR7 and TLR8 expression in pancreatic cancer and point to their significant role in chronic inflammation-mediated TLR7/TLR8 signaling leading to tumor cell proliferation and chemoresistance.
26044169 Intranasal GSK2245035 has an acceptable safety profile at doses that induce local TLR7-mediated immune responses.
26041742 Microenvironmental interleukin-6 suppresses TLR7 signaling in human leukemia cells through miR-17/19A.
26018863 Plasmacytoid dendritic cells from SLE patients carrying the disease-associated PTPN22 variant LypW showed a reduced capacity for TLR-7 agonist-induced type I IFN production.
25941114 High TLR 7 expression is associated with HPV-positive tumors in oropharyngeal squamous cell carcinoma.
25923141 A key regulatory cytokine found increased upon TLR7 stimulation.
25917086 The data reveal a novel role for the N terminus of hTLR7 as a molecular chaperone that provides processed hTLR7 with the correct targeting instructions to reach the endosomal compartment, ensuring its biological activity.
25912131 Present results propose a putative role of TLRs 3,7, and 9 in the growth process of juvenile nasopharyngeal angiofibroma.
25882779 discovery demonstrated that TLR 7 can be activated by coupling an antigen to the terminal carboxyl group at N9 of the inactive ligand adenine analogues
25879168 These findings suggest that the TLR7 IVS1 +1817G/T and TLR7 c.4-151A/G polymorphisms may be important in the susceptibility or clinical course of CCHF disease.
25862837 TLR 2, 4, 5, 7 and 9 appear to reflect certain clinicopathological variables and prognostic markers of MCC tumors
25828894 The low expression of TLR-7 in tumour and high expression of TLR-7 in stroma predict a good clinical outcome for oral squamous cell carcinoma patients
25790192 Results show that patients with Sjogren's syndrome present alteration in B cell subpopulation composition compared to controls, but no significant disparities in TLR-7 and -9 expression is detected between the two groups.
25785446 an important role of 2'-O-methylation for shaping differential TLR7 or TLR8 activation
25763771 These studies identify that TLR7 stimulation leads to the expansion of IL-10-producing CD19(+) CD1d(hi) B cells, which can suppress allergic lung inflammation via T regulatory cells.
25741726 TLR7 receptors are involved in the targeting of axons in the transgenic Drosophila olfactory circuit.
25720442 This study established a correlation between miR-155 and TLR7 during hepatitis B virus infection and also demonstrated in vitro that increased miR-155 level could help to reduce viral load by targeting C/EBP-beta.
25667414 Data show that chemokine CXCL13 production by monocytes required toll-like receptor 7 activation and secretion of interferon-alpha.
25650422 This study provides evidence that a high copy number of TLR7 confers risk for BD in a Chinese Han population.
25430040 rs179010 in TLR7 may be associated with the decreased susceptibility to Graves' disease in Chinese Cantonese.
25401424 Silencing of TLR7 markedly decreased the frequency of HIV-1-infected CD4(+) T cells and restored the responsiveness of those HIV-1(+) CD4(+) T cells.
25309919 The expression of TLR-3, -7, and -9 is increased when the macrophages were treated with the supernatant of cervical cancer cells.
25229618 Humanized TLR7/8 expression drives proliferative multisystemic histiocytosis in C57BL/6 mice
25218653 SNPs in TLR7 had a negative effect on spontaneous clearance of hepatitis C virus among males and a protective effect against hepatitis C infection among females.
25211222 TRAM plays a role in TLR7 signaling through a novel signaling axis towards the activation of anti-viral immunity.
25204046 Data show that a differential mRNA expression of Toll-like receptors 7 & 8 is associated with different responses to pegylated interferon (PEG-IFN) alpha-2b antiviral therapy in patients with hepatitis C infection.
25187660 the UNC93B1 tyrosine-based motif regulates trafficking and TLR responses via separate mechanisms.
25126563 TLRs 3, 7, and 8 are prime biomarker candidates for HCV infection mRNA expression analysis which might improve current therapeutic approaches.
25108054 TLR7 rs179009 GG genotype and haplotype GCG were associated with an increased risk of the susceptibility to HCV infection among Chinese females, which may be due to the impaired IFN-alpha response.
25051971 The results argue against a fixed orientation of the tRNA during interaction with TLR7 and, rather, suggest a processive type of inspection.
25034660 The functional polymorphism of TLR7 rs3853839C allele was found to be sex specific and associated with protection against HCV persistence among Chinese females, which may be due to specific IFN-alpha and IL-6 secretion profiles.
25008898 Hepatitis C virus infection decreases the expression of TLR-3 and TLR-7 via upregulation of miR-758.
25005350 Toll-like receptor 7 may be involved in the development of type 1 autoimmune pancreatitis.
24994112 TLR7 played an important role in macrophage apoptosis and cytokine secretion through the CHOP-dependent pathway.
24990399 expression up-regulated in hepatocellular carcinoma tissue
24971541 These data indicate that imiquimod triggers IP3 receptor-dependent Ca(2+) signaling independently of TLR7.
24919757 Our study confirms the association between the rs3853839 polymorphism of TLR7 and systemic lupus erythematosus in a Danish cohort.
24909816 Results suggest that the TLR7 response following Japanese encephalitis virus infection promotes type-1 interferon production and generation of antiviral state which might contribute to protective effect in systemic infection
24886842 mRNA and corresponding protein expression of TLR3, TLR7, TLR9, RIG-I and MDA-5 were analyzed in nasal biopsies and various upper airway epithelial cell lines.
24866018 Different types of neurons traffic TLR7 to distinct membrane locations, affecting the functional response of neurons to let-7b stimulation.
24865418 Data indicate that Toll-like receptor 7, Toll-like receptor 9, and interferon-alpha expression levels were significantly increased in lupus patients.
24813206 TLR7 and TLR8 can signal in two different "modes" depending on the class of ligand.
24773332 In vitro treatment of PBMCs with R484 hijacks the pro inflammatory immune process triggered by TLRs7/8 to mediate anti-inflammatory response.
24771848 Differently, costimulation of TLR2, TLR4, and TLR7/8 enhances IL-1beta secretion but severely inhibits IL-1Ra production.
24755410 platelet-TLR7 stimulation is independent of thrombosis and has implications to the host immune response and survival.
24747071 the CD4T cell count during the viremic period might be linked to the combination of both TLR7 (Gln11Leu) and TLR9 (1635A/G) genotypes.
24740301 Data show that Toll-like receptor 7 (TLR7) stimulates B cell proliferation at a higher level.
24719462 Heterogeneous functional effects of concomitant B cell receptor and TLR stimulation in chronic lymphocytic leukemia with mutated versus unmutated Ig genes
24692849 TLR3, 7, and 9 play a role in the pathogenesis of SLE and have an impact on organ involvement in systemic lupus erythematosus
24616506 proapoptotic activity is mediated by a microRNA cargo, miR-21, which signals through the Toll-like 7 receptor on myoblasts to promote cell death
24532514 Single nucleotide polymorphism of TLR7 IVS2-151 (rs179009) G/A may be a factor for susceptibility to chronic hepatitis C in the female Han population.
24447081 results reveal broad expression patterns of TLR5 and TLR7 in the lung and that the expression is decreased in severe asthma.
24445780 The TLR7 rs179010 T risk allele was also associated with anti-SSA autoantibodies. These findings suggest that TLR7 may play a key role in autoantibody production
24390332 Combined activation of TLR7/8 and TLR9 by TLR7/8 and TLR9 agonists induces the highest titers of binding, neutralizing, and antibody-dependent cellular cytotoxicity-mediating antibodies against HIV-1 Env/gp140
24375473 Data indicate Bruton's tyrosine kinase (Btk) as a key molecule in TLR9 signaling in plasmacytoid dendritic cells (PDCs) and the TLR7 and TLR9 pathways can be dissociated in PDCs.
24347177 TLR7 was expressed by Hela cells.
24269682 Data indicate the ability of C protein to block Toll-like receptor (TLR) 7- and TLR9-dependent IFN-alpha induction.
24227841 A-to-I editing of structured viral RNAs facilitated the activation of TLR7 and TLR8.
24138882 Processing of human toll-like receptor 7 by furin-like proprotein convertases is required for its accumulation and activity in endosomes.
24071890 In females, the incidence of the X-linked TLR7 rs179008/Gln11Leu polymorphism was significantly lower in sarcoidosis patients.
24046015 Data indicate that TLR-induced IL-1beta overproduction in FANCA- and FANCC-deficient mononuclear phagocyte cell lines and primary cells requires activation of the inflammasome.
23924358 Toll-like receptor 7 is a pattern recognition receptor in the lungs that detects single-stranded RNA genomes.
23827939 Neu1 sialidase and matrix metalloproteinase-9 cross-talk regulates nucleic acid-induced endosomal TOLL-like receptor-7 and -9 activation, cellular signaling and pro-inflammatory responses.
23636665 our data unveil a novel TLR7-regulated mechanism in in vivo IFN-beta-stimulated whole leukocytes that could be exploited to define new TLR7-based strategies for the treatment of multiple sclerosis
23564191 The presence of anti-ENA and anti-dsDNA autoantibodies in SLE patients was associated with elevated levels of TLR7 and TLR9 respectively.
23526932 homology modeling and molecular docking studies were employed to probe the intermolecular interactions between TLR7 and its agonists
23523654 Results of the current study have shown that some clinical enterovirus strains hold a great potential to elicit cytokines response, which is mediated in part by TLR7 activation.
23497717 Elevated levels of TLR7 signaling molecules and their positive correlation with disease activity in adult-onset Still's disease patients suggest involvement of the TLR7 signaling pathway in the pathogenesis of this disease
23489702 Liver expression of TLR2, TLR3 and TLR7, which are more involved in the immune-pathogenesis of chronic hepatitis C, was investigated.
23468661 Reduced modulation by miR-3148 conferred slower degradation of the risk G-allele containing TLR7 transcripts. These data establish rs3853839 of TLR7 as a shared risk variant of SLE(systemic lupus erythematosus )
23425350 Impaired TLR3 and TLR7/8-mediated cytokine responses may contribute to aggressive HCV recurrence postliver transplantation
23386618 Complement receptor 3 influences toll-like receptor 7/8-dependent inflammation
23383108 Combined activation of TLR7/8 and TLR9 by TLR7/8 and TLR9 agonists induces the highest titers of binding, neutralizing, and antibody-dependent cellular cytotoxicity-mediating antibodies against HIV-1 Env/gp140
23382558 Type I interferon (IFN)-dependent inhibition of T cell-derived interleukin (IL)-5 is mediated by IFN-alpha acting directly on activated T cells.
23376919 IRAK-M mediates TLR7-induced MEKK3-dependent second wave NFjB activation to produce inhibitory molecules
23369718 Studies indicate that the nucleic acid-sensing toll-like receptors (TLRs), which include TLRs 3, 7, 8 and 9 are completely localized within the endosomal compartments of immune cells and recognize RNA and DNA from pathogens.
23316755 Combined activation of TLR7/8 and TLR9 by TLR7/8 and TLR9 agonists induces the highest titers of binding, neutralizing, and antibody-dependent cellular cytotoxicity-mediating antibodies against HIV-1 Env/gp140
23221735 Cervical tumor Langerhans cells lacked TLR9 expression and were functionally anergic to all the 3: TLR7, TLR8, and TLR9 ligands, which may play a crucial role in immune tolerance.
23179584 TLR7 expression was not associated with prognosis in cutaneous malignant melanoma.
23150717 Enhanced B-cell TLR7 expression permits specific development of autoantibodies to RNA/protein complexes, which exacerbate the chronic systemic autoimmune disease, systemic lupus erythematosus.
23069256 Hepatitis virus induces down-regulation of TLR7 gene expression through IFN-gamma, thereby modulating inflammatory signaling in hepatoma cells.
23023703 TLR7 ligation modulates pancreatic cancer by driving stromal inflammation.
22952899 The present study was undertaken to characterize responses of B cells from systemic lupus erythematosus patients to TLR7 and TLR9 stimulation and to explore the potential role of SIGIRR.
22952664 Toll-like receptor 7 stimulates the expression of Epstein-Barr virus latent membrane protein 1
22857391 Single nucleotide polymorphism in the TLR7 gene is associated with allergic rhinitis.
22787112 TLR7, a receptor recognizing self-nucleic acid complexes, is protective in atherosclerosis.
22786773 These new findings reveal distinct and overlapping signaling mechanisms used by B-cell antigen receptor and IFNAR in the regulation of TLR7 tolerance and activation.
22730373 These results suggest that expression of TLR7, but not TLR8, may be a predictor for rheumatoid arthritis disease activity
22684144 Impaired IFN-alpha production from plasmacytoid dendritic cells (pDCs) may contribute to the immunopathogenesis of chronic HBV infection, which may be the result of a reduced amount of pDCs as well as decreased expression of TLR7 and TLR9 on pDCs
22610069 extracellular let-7 activates the RNA-sensing Toll-like receptor (TLR) 7 and induces neurodegeneration through neuronal TLR7
22543675 TLR7 was expressed in macrophages in atherosclerotic plaques.
22525943 Authors demonstrate the use of ImageStream in DCs to assess TLR7/8 activation-mediated increases in phosphorylation and nuclear translocation of a key transcription factor.
22505023 TLR7 gene rs1634323 polymorphism may contribute to SLE susceptibility in females.
22488361 PACSIN1 represents a pDC-specific adaptor molecule that plays an important role in the TLR7/9-mediated type I IFN responses by pDCs in vitro and in vivo.
22423970 Systematic identification of novel cofactors required for TLR7 and TLR9 directed innate immunity signaling responses.
22363482 Segments 1, 2, 3 and 4 may be major determinants of the stimulatory activity exerted on human TLRs 7 and 8.
22243920 The study provides evidence that the TLR7 and TLR8 triggering can suppress HIV replication in monocytes and lead to postpone HIV disease progression.
22210629 Responsiveness to TLR7/8 stimulation, which have been shown to recognize HIV-1 ssRNA, did not decrease in chronic infection, and may represent a contributing factor to ongoing T-cell immune activation in the setting of chronic viremic HIV-1 infection.
22196370 Dual or triple activation of TLR7, TLR8, and/or TLR9 by single-stranded oligoribonucleotides.
22065095 We suggest that TLR7 rs179008 and TLR9 rs5743836 can be considered systemic lupus erythematosus susceptibility factors for women of European descent
22022576 Variations in TLR7 and TLR8 genes might impair immune responses during hepatitis C virus infection.
21990957 Data suggest that TLR3, TLR4, TLR7 and TLR9 expression is important to the biological pathogenesis of esophageal squamous cell carcinoma.
21977996 Data suggest that the response pattern of human and rhesus B cells and pDCs to TLR7/8 and TLR9 is similar, although some differences in the cell surface phenotype of the differentiating cells exist.
21958189 Study suggests that the regulatory signals associated with CD19 and CD5 in Chronic Lymphocytic Leukemia (CLL) are down-regulated by Toll-like receptor-7 (TLR-7) engagement.
21947541 we found no evidence of any functional effects of TLR7 or TLR8 polymorphisms on receptor expression, measles-specific cellular responses or measles vaccine antibody responses.
21844166 TLR7/9 versus TLR3/MDA5 signaling during virus infections and diabetes.
21734241 monoclonal antiphospholipid antibodies as well as IgG fractions from patients with antiphospholipid syndrome increase mRNA expression of the intracellular TLR7 in plasmacytoid dendritic cells and TLR8 in monocytes
21730058 endothelin-1 has a role in linking Toll-like receptor 7-mediated inflammation to fibrosis in congenital heart block
21677671 Toll-like receptors (TLRs) 6, 7, and 8 are upregulated in keloid scars
21543762 Toll-like receptor 7 is crucial for development of age-related B cell population.
21527067 High expression of TLR4, TLR7, and TLR9 may play important roles in the development and progression of cervical intraepithelial neoplasia and cervical squamous cell carcinoma in Uighur women.
21515789 Data show that that TLRs 3, 7, and 9 are expressed by human dorsal root ganglion neurons (DRGNs) and in cultures of primary mouse DRGNs.
21458848 TLR7 promotes Th1 polarization and may contribute thus in the pathogenesis of immune thrombocytopenia.
21435390 Cigarette smoke suppresses key plasmacytoid dendritic cells functions upon viral infection by a mechanism that involves downregulation of TLR7 expression and decreased activation of IRF-7.
21396113 Our findings support a role of TLR7 in predisposition for systemic lupus erythematosus in Asian populations.
21354862 TLR 7 and TLR8 expressions are associated with poor outcome and greater inflammatory response in acute ischemic stroke.
21167247 There is no suggestive relationship between TLR7 gene polymorphisms and susceptibility to Behcet Syndrome.
21092001 Suppressed G-CSF production in the presence of IFN-alpha may contribute to IFN-alpha-induced neutropenia. However, a TLR7/8 agonist elicits G-CSF secretion even in the presence of IFN-alpha.
21061265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21039888 TLR7 regulates DC-dependent B-cell responses through BlyS in the pathogenesis of ITP
21037581 TLR7 is important for pruritus elicited primarily by nonhistaminergic pruritogens, although a partial role of TLR7 in histamine-dependent itch is not excluded.
20977567 Observational study of gene-disease association. (HuGE Navigator)
20872712 The Toll-like receptor 7 rs179008/Gln11Leu gene variant was associated with the presence of portal lymphoid aggregates in chronic hepatitis C infection.
20832340 Human CD14dim monocytes patrol and sense nucleic acids and viruses via TLR7 and TLR8 receptors.
20821041 B cells can be directly activated viaTLR1/TLR2, TLR7, and TLR9 to induce secretion of cytokines, chemokines, and hematopoietic growth factors and suggest a role of B cells in immune response against microbial pathogenesis and immune homeostasis.
20819670 The concentrations of TLR1, TLR3, TLR4, TLR7 and TLR9 appeared to be increased in bacterial pleural effusion compared to non-bacterial pleural effusions.
20733074 data established a functional polymorphism in type I IFN pathway gene TLR7 predisposing to systemic lupus erythematosus, especially in Chinese and Japanese male subjects
20733074 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20605567 SV5 induced interferon alpha secretion by plasmacytoid dendritic cells requires signaling throught TLR7 and autophagy. pathways.
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592251 Human plasmacytoid predendritic cells were highly sensitive to glucocorticoid-induced apoptosis but they were protected by microbial stimulation through TLR7 and TLR9.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20559388 a new role for self nucleic acid recognition by toll-like receptors TLR7 and TLR9 on B cells and plasmacytoid dendritic cells
20525845 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20412752 TLR8 contributes to lung inflammation, NSCLC progression, cell survival via BCL-2 production & resistance to antineoplastic agents. Review.
20410486 counterregulation of FcepsilonRI and TLR-7 pathways exists in Plasmacytoid dendritic cells
20399690 In individuals affected by primary Sjogren's syndrome, TLR7 mRNA levels are up-regulated in the mononuclear blood cells and TLR7-positive cells exist in the epithelial islands, lymphocytes, and ductal epithelial cells of the parotid glands.
20390327 a TLR7-dependent impairment of costimulatory molecule expression caused by HCV persistence may affect DC activity in non-responder patients.
20309865 Our findings indicate that TLR-3 and TLR-7 are expressed in inflammatory myopathic tissues, particularly in immature myoblast precursors.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237413 Triggering of TLR7 and TLR8 expressed by human lung cancer cells induces cell survival and chemoresistance.
20227302 Observational study of gene-disease association. (HuGE Navigator)
20194452 Observational study of gene-disease association. (HuGE Navigator)
20124101 Data show that TLR activation was associated with significantly increased production of IL-1beta, IL-6, TNF-alpha, and CCL3.
20100933 Studies show substantial decreases in older compared with young individuals in cytokine production in response to TLR1/2, TLR6, TLR3, TLR5, and TLR8, TLR7 and TLR9 in DCs.
20042593 Sensing of human metapneumovirus 5' triphosphate RNA is via TLR7 rather than the viral RNA helicase retinoic acid-inducible gene RIG-I.
20026744 TLR7 activation in plasmacytoid dendritic cells represents a missing link between innate and adaptive immune mechanisms and contributes to the amplification of T helper cell interleukin (Th)17-driven autoimmune disorders as well as viral host defense.
20007807 Plasmacytoid dendritic cells respond to cell-free human T-cell leukemia virus 1 by producing high levels of IFN-alpha and by mobilizing TRAIL on cell surface after TLR7 triggering.
19954299 the abnormal expression of TLR7 in CD8(+) T cells from HIV-1-infected individuals may contribute to the abnormal immune activation in HIV-1 infection
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19915052 When dendritic cells were triggered with the potent synergistic combination of TLR4 and TLR7/8 in conjunction with a TLR2 ligand, there was a clear shift to more Th2- and Th17-prone responses in the naive and memory T cell subpopulations
19913121 Observational study of gene-disease association. (HuGE Navigator)
19887600 TLR3 or TLR7 ligand stimulation of tumor cells enhances the cytotoxic activity of expanded gammadelta T cells of cancer patients in vitro.
19841637 Activation of endosomal TLRs 7, 8 and 4 leads to downregulation of degradative HIF-1 alpha prolyl hydroxylation.
19821521 Reduced TLR7 expression, due to RNA instability, directly correlates with HCV replication and alters TLR7-induced IRF7-mediated cell activation. These results suggest a role for TLR7 in HCV-mediated evasion of host immune surveillance.
19794067 These results reveal a TLR7/9-dependent signaling pathway used by human PBMCs to initiate a type I IFN response to the extracellular bacterium B. burgdorferi.
19740627 Cultured human melanocytes express functional toll-like receptors 2-4, 7 and 9.
19614650 Observational study of gene-disease association. (HuGE Navigator)
19564354 Data show that BST2 directly binds to purified ILT7, initiates signaling via the ILT7-FcepsilonRIgamma complex, and regulates TLR7/9 responses in plasmacytoid dendritic cells.
19553637 plasmacytoid dendritic cells , through this unusual TLR7 signaling, have the capacity to promptly respond to viral infection during the early phases of the innate immune response
19527514 Observational study of gene-disease association. (HuGE Navigator)
19505919 Observational study of gene-disease association. (HuGE Navigator)
19473567 there were no statistically significant differences between the allele and genotype distribution of TLR5 (toll-like receptor 5) rs5744168 and TLR7 (toll-like receptor 7) rs179008 polymorphisms in Systemic lupus erythematosus patients and controls
19473567 Observational study of gene-disease association. (HuGE Navigator)
19454678 In pDC, recognition of ssRNA and dsRNA oligonucleotides was TLR7-dependent
19452306 The mRNA levels for TLR7 were increased among the children with a history of OME.
19406482 expressed on Fallopian tube and uterus
19381167 The ligand-induced activation of TLR7 leads to the accumulation of hypoxia-inducible factor 1 alpha (HIF-1alpha) protein in THP-1 human myeloid macrophages via redox- and reactive nitrogen species-dependent mechanisms.
19265114 Synergy between TLR4 and TLR7/8 controls the sequential production of regulatory and proinflammatory cytokines interleukin (IL)-10, interferon (IFN)-gamma, and IL-17A by naive CD4-positive T cells.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19164127 the Jak/STAT signaling pathway was involved in CD40 expression and cytokine production in TLR7-stimulated DCs but negatively regulated CD83 expression and cytokine secretion in DCs activated through TLR8
19129482 activation via TLR7 and TLR9 affects several eosinophil functions
19120473 inappropriate activation of TLR7 predisposes to systemic lupus erythematosus and other autoimmune diseases; nucleotides with antagonistic effect on TLR7 reported for the treatment
19114863 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18995892 Perturbation of TLR-7 on naive human B cells can lead to the induction of immunoglobulin class switch and IgG production in the absence of B-cell receptor cross-linking and CD40-CD40L interaction.
18949362 Up-regulation of natural killer cell function against head and neck cancer in response to single-stranded immunostimulatory RNA requires TLR7.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18806803 Divergent TLR7 and TLR9 signaling and type I interferon production distinguish pathogenic and nonpathogenic AIDS virus infections.
18686608 Human epidermal keratinocytes constitutively express all TLR 1-10 mRNA, which may enable human keratinocytes to respond to a wide range of pathogenic micro-organisms.
18682521 replicated association was obtained for SNPs or haplotypes of TLR7 and TLR8, suggesting these genes as novel disease genes for asthma and related disorders.
18596825 the Toll-like receptor 7 agonist imiquimod inhibits melanogenesis and proliferation of human melanocytes
18535206 CD300a and CD300c play an important role in the cross-regulation of TNF-alpha and IFN-alpha secretion from pDCs; CD300a/c RNA and surface expression were downregulated after stimulation of pDCs with TLR7 and TLR9 ligands
18474259 TLR-7 signaling stimulates apoptosis resistance, associated with enhanced iNOS expression (protein and mRNA) and NO release, notably through an NF-kappaB-dependent activation of the NO pathway.
18431484 These results delineate the complex effects of triggering TLR7/8 for an efficient antiviral defense.
18406377 TLR7-9 recognize single-stranded RNA, nucleoside analogs and single-stranded CpG-DNA, respectively, and their activation initiates the immune response against viruses and bacteria [review]
18385087 TLR variants are unlikely to have a major impact on overall AMD risk, and the common variants studied were not associated with AMD.
18385087 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18250417 Direct involvement of human TLR7 is demonstrated in the induction of tumor necrosis factor (TNF)-alpha by single-stranded RNAs in the macrophage-like THP-1 cell line.
18215354 There is downregulation of TLR7 expression mRNA in peripheral blood mononuclear cells of hepatitis B virus-infected patients
18088248 This study reports the association of TLR7 variants with chronic HCV-infection and with the response to interferon-alpha therapy in patients with chronic HCV-infection.
18088248 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18021446 Our results show that PAMP receptors, TLR3, TLR7 and RIG-I mRNA levels are significantly down-regulated in patients with chronic hepatitis C infection when compared with healthy controls.
17964520 Observational study of genotype prevalence. (HuGE Navigator)
17956986 IFN-alpha produced after HIV-induced TLR7 stimulation was responsible for TRAIL expression and the down-regulation of both CXCR4 and CCR5 by IKpDC
17907191 Observational study of gene-disease association. (HuGE Navigator)
17907191 relative gene copy number of TLR7 was not significantly increased among our SLE patients as compared with our controls.No trend between the relative gene copy number and the autoantibody profile in SLE patients.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17698957 Both types of compounds induced IFN-gamma-inducible protein 10, but only the 7-deazaguanosine-containing compound that activated both TLR7 and TLR8 induced IFN-alpha in monkeys
17609264 Epstein-Barr virus initially uses TLR7 signaling to enhance B-cell proliferation and subsequently modifies the pathway to regulate IRF-5 activity.
17608805 CYLD, a novel deubiquitinase, acts as a negative regulator of TLR7 induction by nontypeable Haemophilus influenzae
17512627 Observational study of gene-disease association. (HuGE Navigator)
17512627 The c.1-120G TLR7 allele offers protection from the development of inflammation and fibrosis in male patients with chronic HCV-infection.
17371961 Our data reveal for the first time a strong inhibitory effect of TLR7 stimulation on IFN-alpha production induced by CpG-A- and CpG-C-ODNs.
17301562 Observational study of gene-disease association. (HuGE Navigator)
17075576 results implicate involvement of toll-like receptors, particularly TLR7, and type 1 specific interferon signaling in the pathogenesis of BA, especially in early stage, which is associated with upregulation of inflammatory cytokines IL-8
17040905 TLR8 inhibits TLR7 and TLR9, and TLR9 inhibits TLR7 but not vice versa in HEK293 cells transfected with TLRs in a pairwise combination.
17023556 These data lead us to suggest that ongoing viral activation of TLR7/8 could alter the adaptive immune response by modifying DC differentiation and by down-regulating DC responsiveness to a subsequent bacterial TLR4-mediated signal.
16973388 Autoantibody production is largely dependent on Toll-like receptor 7 (TLR7) and causes kidney pathology in nucleic acid-containing autoantigen knockin mice.
16935934 TLR3 agonist poly(I:C) activated epithelial cells, primary endothelial cells, and two types of primary human smooth muscle cells (airway [ASMC] and vascular) directly, while the TLR7/8 agonist R848 required the presence of leukocytes to activate ASMC
16887967 A profound sex-dependent pathway of TLR7-induced interferon (IFN)-alpha production is revealed with higher production in females.
16623926 Stimulation of in vitro-generated murine Toll-like receptor 7 (TLR7) knockout DC and human TLR-transfected HEK293 cells with dsRNA fragments gave no evidences for the involvement of pDC-specific TLR7 or TLR9 in the observed IFN-alpha induction.
16517754 TLR-7 "licenses" human B cells to respond to cytokines of the adaptive immune system (such as IL-2) and provide a strategy to increase the immunogenicity of lymphoma cells for therapeutic purposes
16446426 evidence showing that a ligand of Toll-like receptor 7 (TLR7) can induce anti-HCV immunity not only by IFN induction, but also through an IFN-independent mechanism
16230478 TLR9 may have a critical role in the promotion of lupus through the induction of IFN-alpha by predendritic cells.
16116638 The agonist isatoribine resulted in dose-dependent changes in immunologic biomarkers and a statistically significant antiviral effect with relatively few and mild side effects in hepatitis C.
16025564 TLR7 acts as a host sensor for human parechovirus 1, and activates signalling that leads to the synthesis of pro-inflammatory molecules by the host.
15778362 Plasmacytoid dendritic cell-derived type I IFN enhanced TLR7 sensitivity of B cells by selectively up-regulating TLR7 expression
15695821 IRF5 and IRF7 are critical mediators of TLR7 signaling
12045249 Interferon-alpha and interleukin-12 are induced differentially by Toll-like receptor 7 ligands in human blood dendritic cell subsets.
12032557 Human TLR7 or TLR8 independently confer responsiveness to the antiviral compound R-848.

AA Sequence

MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNL      1 - 70
TLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLL     71 - 140
EIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLS    141 - 210
LKDNNVTAVPTVLPSTLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQ    211 - 280
IPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFN    281 - 350
FELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF    351 - 420
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNKEASFMSVNES    421 - 490
CYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHST    491 - 560
AFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNH    561 - 630
LDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKN    631 - 700
LETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPEN    701 - 770
VLNNLKMLLLHHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL    771 - 840
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLA    841 - 910
ELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMD    911 - 980
EKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV     981 - 1049
//

Text Mined References (250)

PMID Year Title
26903634 2016 Differences in codon bias and GC content contribute to the balanced expression of TLR7 and TLR9.
26741133 2016 Gene Polymorphism of Toll-Like Receptors and Lung Function at Five to Seven Years of Age after Infant Bronchiolitis.
26725554 2015 Associations of Toll-like receptor 7 and 8 Polymorphisms with Asthma and Asthma-related Phenotypes in a Chinese Han Population.
26723518 2016 Increased expression of Toll-like receptors 7 and 9 in myasthenia gravis thymus characterized by active Epstein-Barr virus infection.
26718740 2016 Activation of Toll-like receptor 7 regulates the expression of IFN-?1, p53, PTEN, VEGF, TIMP-1 and MMP-9 in pancreatic cancer cells.
26512111 2015 RNA sensing by conventional dendritic cells is central to the development of lupus nephritis.
26483222 2015 [Expression and significance of toll-like receptors 7 and 8 in brain and lung tissues of death cases caused by EV71 infection].
26371257 2015 Identification of Thiostrepton as a Novel Inhibitor for Psoriasis-like Inflammation Induced by TLR7-9.
26363072 2015 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via Toll-like receptor 7 signaling.
26340429 2015 Hyper-responsive Toll-like receptor 7 and 9 activation in NADPH oxidase-deficient B lymphoblasts.
26315138 2015 Roles of Toll-like Receptor 7 and 8 in Prevention of Intrauterine Transmission of Hepatitis B Virus.
26255864 2015 Type I IFN-mediated synergistic activation of mouse and human DC subsets by TLR agonists.
26238718 2015 Activation of Toll-like receptor 7 inhibits the proliferation and migration, and induces the apoptosis of pancreatic cancer cells.
26198699 2015 Invariant chain is a new chaperone for TLR7 in B cells.
26134824 2015 TLR7 and TLR8 expression increases tumor cell proliferation and promotes chemoresistance in human pancreatic cancer.
26044169 2015 Early clinical evaluation of the intranasal TLR7 agonist GSK2245035: Use of translational biomarkers to guide dosing and confirm target engagement.
26041742 2015 Microenvironmental interleukin-6 suppresses toll-like receptor signaling in human leukemia cells through miR-17/19A.
26018863 2015 PTPN22 Variant R620W Is Associated With Reduced Toll-like Receptor 7-Induced Type I Interferon in Systemic Lupus Erythematosus.
25941114 2015 Expression of toll-like receptors in HPV-positive and HPV-negative oropharyngeal squamous cell carcinoma--an in vivo and in vitro study.
25923141 2015 IFN-? Therapy Regulates TLR7-Mediated Response in Plasmacytoid Dendritic Cells of Multiple Sclerosis Patients Influencing an Anti-Inflammatory Status.
25917086 2015 The Processed Amino-Terminal Fragment of Human TLR7 Acts as a Chaperone To Direct Human TLR7 into Endosomes.
25912131 2015 Toll-like receptors 3, 7, and 9 in Juvenile nasopharyngeal angiofibroma.
25882779 2015 Toll-like receptor 7 inactive ligands enhanced cytokine induction by conjugation to weak antigens.
25879168 2015 Toll-like receptor 7 Gln11Leu, c.4-151A/G, and +1817G/T polymorphisms in Crimean Congo hemorrhagic fever.
25862837 2015 The expression of Toll-like receptors 2, 4, 5, 7 and 9 in Merkel cell carcinoma.
25828894 2015 Distinct expression patterns of Toll-like receptor 7 in tumour cells and fibroblast-like cells in oral squamous cell carcinoma.
25790192 2015 Expression of Toll-like receptor -7 and -9 in B cell subsets from patients with primary Sjögren's syndrome.
25785446 2015 A single naturally occurring 2'-O-methylation converts a TLR7- and TLR8-activating RNA into a TLR8-specific ligand.
25763771 2015 Ligation of TLR7 on CD19(+) CD1d(hi) B cells suppresses allergic lung inflammation via regulatory T cells.
25741726 2015 Toll receptors instruct axon and dendrite targeting and participate in synaptic partner matching in a Drosophila olfactory circuit.
25720442 2015 Expression of microRNA-155 correlates positively with the expression of Toll-like receptor 7 and modulates hepatitis B virus via C/EBP-? in hepatocytes.
25667414 2015 HIV-1 single-stranded RNA induces CXCL13 secretion in human monocytes via TLR7 activation and plasmacytoid dendritic cell-derived type I IFN.
25650422 2015 Association Between Copy Number Variations of TLR7 and Ocular Behçet's Disease in a Chinese Han Population.
25430040 2015 Association of Toll-like receptor 7 and 8 gene polymorphisms with Graves' disease in Chinese Cantonese population.
25401424 2015 TLR7 induces anergy in human CD4(+) T cells.
25309919 2014 Cervical cancer cell supernatants induce a phenotypic switch from U937-derived macrophage-activated M1 state into M2-like suppressor phenotype with change in Toll-like receptor profile.
25229618 2014 Humanized TLR7/8 expression drives proliferative multisystemic histiocytosis in C57BL/6 mice.
25218653 2015 Single nucleotide polymorphisms of toll-like receptor 7 in hepatitis C virus infection patients from a high-risk chinese population.
25211222 2014 The TIR-domain containing adaptor TRAM is required for TLR7 mediated RANTES production.
25204046 2014 Differential expression of Toll-like receptors 7 & 8 mRNA in monocytes of patients with chronic hepatitis C infection: correlation with interferon and ribavirin treatment.
25187660 2014 Cutting edge: the UNC93B1 tyrosine-based motif regulates trafficking and TLR responses via separate mechanisms.
25126563 2014 Modulation of TLR 3, 7 and 8 expressions in HCV genotype 3 infected individuals: potential correlations of pathogenesis and spontaneous clearance.
25108054 2014 Toll-like receptor 7 variations are associated with the susceptibility to HCV infection among Chinese females.
25051971 2014 A modified dinucleotide motif specifies tRNA recognition by TLR7.
25034660 2014 Sex-specific association between X-linked Toll-like receptor 7 with the outcomes of hepatitis C virus infection.
25008898 2014 Hepatitis C virus infection decreases the expression of Toll-like receptors 3 and 7 via upregulation of miR-758.
25005350 2015 Possible involvement of Toll-like receptor 7 in the development of type 1 autoimmune pancreatitis.
24994112 2014 Toll-like receptor 7 promotes the apoptosis of THP-1-derived macrophages through the CHOP-dependent pathway.
24990399 2015 Effect of toll-like receptor 7 and 9 targeted therapy to prevent the development of hepatocellular carcinoma.
24971541 2014 Imiquimod induces a Toll-like receptor 7-independent increase in intracellular calcium via IP(3) receptor activation.
24919757 2014 Single nucleotide polymorphisms in genes encoding toll-like receptors 7, 8 and 9 in Danish patients with systemic lupus erythematosus.
24909816 2014 TLR7 is a key regulator of innate immunity against Japanese encephalitis virus infection.
24886842 2014 Functional effects of Toll-like receptor (TLR)3, 7, 9, RIG-I and MDA-5 stimulation in nasal epithelial cells.
24866018 2014 Location is everything: let-7b microRNA and TLR7 signaling results in a painful TRP.
24865418 2014 Increased expression of Toll-like receptors (TLRs) 7 and 9 and other cytokines in systemic lupus erythematosus (SLE) patients: ethnic differences and potential new targets for therapeutic drugs.
24813206 2014 RNA and imidazoquinolines are sensed by distinct TLR7/8 ectodomain sites resulting in functionally disparate signaling events.
24773332 2014 R848, a Toll-like receptors 7 and 8 agonist, a potential therapy for allergic rhinitis patients.
24771848 2014 TLR costimulation causes oxidative stress with unbalance of proinflammatory and anti-inflammatory cytokine production.
24755410 2014 Platelet-TLR7 mediates host survival and platelet count during viral infection in the absence of platelet-dependent thrombosis.
24747071 2014 Association of single-nucleotide polymorphisms in TLR7 (Gln11Leu) and TLR9 (1635A/G) with a higher CD4T cell count during HIV infection.
24740301 2014 Interleukin-7 and Toll-like receptor 7 induce synergistic B cell and T cell activation.
24719462 2014 Heterogeneous functional effects of concomitant B cell receptor and TLR stimulation in chronic lymphocytic leukemia with mutated versus unmutated Ig genes.
24692849 2014 Expression of toll-like receptors 3, 7, and 9 in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
24616506 2014 Microvesicles containing miRNAs promote muscle cell death in cancer cachexia via TLR7.
24532514 2014 Single nucleotide polymorphisms of toll-like receptor 7 and toll-like receptor 9 in hepatitis C virus infection patients from central China.
24447081 2014 Mapping of TLR5 and TLR7 in central and distal human airways and identification of reduced TLR expression in severe asthma.
24445780 2014 Genetic variations in Toll-like receptors (TLRs 3/7/8) are associated with systemic lupus erythematosus in a Taiwanese population.
24375473 2014 Bruton's tyrosine kinase regulates TLR9 but not TLR7 signaling in human plasmacytoid dendritic cells.
24347177 2014 The activation of TLR7 regulates the expression of VEGF, TIMP1, MMP2, IL-6, and IL-15 in Hela cells.
24269682 2014 An anti-interferon activity shared by paramyxovirus C proteins: inhibition of Toll-like receptor 7/9-dependent alpha interferon induction.
24227841 2014 Inosine-mediated modulation of RNA sensing by Toll-like receptor 7 (TLR7) and TLR8.
24138882 2013 Processing of human toll-like receptor 7 by furin-like proprotein convertases is required for its accumulation and activity in endosomes.
24071890 2013 ?TLR7 Gln11Leu single nucleotide polymorphism in patients with sarcoidosis.
24046015 2013 FANCA and FANCC modulate TLR and p38 MAPK-dependent expression of IL-1? in macrophages.
23924358 2013 Toll-like receptor 7 rapidly relaxes human airways.
23827939 2013 Neu1 sialidase and matrix metalloproteinase-9 cross-talk regulates nucleic acid-induced endosomal TOLL-like receptor-7 and -9 activation, cellular signaling and pro-inflammatory responses.
23636665 2013 IFN-? therapy modulates B-cell and monocyte crosstalk via TLR7 in multiple sclerosis patients.
23564191 2013 Distinct autoantibody profiles in systemic lupus erythematosus patients are selectively associated with TLR7 and TLR9 upregulation.
23526932 2013 Toll-like receptor 7 agonists: chemical feature based pharmacophore identification and molecular docking studies.
23523654 2013 Differential TLR7-mediated expression of proinflammatory and antiviral cytokines in response to laboratory and clinical enterovirus strains.
23497717 2013 Involvement of TLR7 MyD88-dependent signaling pathway in the pathogenesis of adult-onset Still's disease.
23489702 In vivo liver expression of TLR2, TLR3 and TLR7 in chronic hepatitis C.
23468661 2013 MicroRNA-3148 modulates allelic expression of toll-like receptor 7 variant associated with systemic lupus erythematosus.
23425350 2013 Toll-like receptor 3 and 7/8 function is impaired in hepatitis C rapid fibrosis progression post-liver transplantation.
23386618 2013 Complement receptor 3 influences toll-like receptor 7/8-dependent inflammation: implications for autoimmune diseases characterized by antibody reactivity to ribonucleoproteins.
23382558 2013 TLR7 stimulation of APCs results in inhibition of IL-5 through type I IFN and Notch signaling pathways in human peripheral blood mononuclear cells.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376919 2013 IRAK-M mediates Toll-like receptor/IL-1R-induced NF?B activation and cytokine production.
23369718 2013 Recognition of pathogen-associated nucleic acids by endosomal nucleic acid-sensing toll-like receptors.
23221735 2013 Toll-like receptors 7, 8, and 9 expression and function in primary human cervical cancer Langerhans cells: evidence of anergy.
23179584 2013 Expression of TLR3, 4, 7 and 9 in cutaneous malignant melanoma: relationship with clinicopathological characteristics and prognosis.
23150717 2012 B cell TLR7 expression drives anti-RNA autoantibody production and exacerbates disease in systemic lupus erythematosus-prone mice.
23069256 2013 Down-regulation of Toll-like receptor 7 expression in hepatitis-virus-related human hepatocellular carcinoma.
23023703 2012 Toll-like receptor 7 regulates pancreatic carcinogenesis in mice and humans.
22952899 2012 The largely normal response to Toll-like receptor 7 and 9 stimulation and the enhanced expression of SIGIRR by B cells in systemic lupus erythematosus.
22952664 2012 Toll-like receptor 7 stimulates the expression of Epstein-Barr virus latent membrane protein 1.
22857391 2012 Toll-like receptor gene polymorphisms are associated with allergic rhinitis: a case control study.
22787112 2012 Toll-like receptor 7 protects from atherosclerosis by constraining "inflammatory" macrophage activation.
22786773 2012 Type I IFN receptor and the B cell antigen receptor regulate TLR7 responses via distinct molecular mechanisms.
22730373 2013 Ligation of TLR7 by rheumatoid arthritis synovial fluid single strand RNA induces transcription of TNF? in monocytes.
22684144 2012 Downregulation of TLR7/9 leads to deficient production of IFN-? from plasmacytoid dendritic cells in chronic hepatitis B.
22610069 2012 An unconventional role for miRNA: let-7 activates Toll-like receptor 7 and causes neurodegeneration.
22543675 2012 Toll-like receptor 7 stimulation by imiquimod induces macrophage autophagy and inflammation in atherosclerotic plaques.
22525943 2012 Quantitative imaging of lineage-specific Toll-like receptor-mediated signaling in monocytes and dendritic cells from small samples of human blood.
22505023 2012 The TLR7 7926A>G polymorphism is associated with susceptibility to systemic lupus erythematosus.
22488361 2012 PACSIN1 regulates the TLR7/9-mediated type I interferon response in plasmacytoid dendritic cells.
22423970 2012 Cofactors required for TLR7- and TLR9-dependent innate immune responses.
22363482 2012 A comparative study of human TLR 7/8 stimulatory trimer compositions in influenza A viral genomes.
22243920 2012 R-848 triggers the expression of TLR7/8 and suppresses HIV replication in monocytes.
22210629 2012 Differential regulation of toll-like receptor pathways in acute and chronic HIV-1 infection.
22196370 2011 Dual or triple activation of TLR7, TLR8, and/or TLR9 by single-stranded oligoribonucleotides.
22065095 2012 TLR7/8/9 polymorphisms and their associations in systemic lupus erythematosus patients from southern Brazil.
22022576 2011 TLR7 and TLR8 gene variations and susceptibility to hepatitis C virus infection.
21990957 2011 Overexpression of TLR3, TLR4, TLR7 and TLR9 in esophageal squamous cell carcinoma.
21977996 2011 Human and rhesus plasmacytoid dendritic cell and B-cell responses to Toll-like receptor stimulation.
21958189 2012 Active Toll-like receptor-7 triggering of chronic lymphocytic leukemia B-cells by imiquimod.
21947541 2012 Toll-like receptor 7 and 8 polymorphisms: associations with functional effects and cellular and antibody responses to measles virus and vaccine.
21844166 2011 TLR7/9 versus TLR3/MDA5 signaling during virus infections and diabetes.
21734241 2011 Antiphospholipid antibodies induce translocation of TLR7 and TLR8 to the endosome in human monocytes and plasmacytoid dendritic cells.
21730058 2011 A novel role of endothelin-1 in linking Toll-like receptor 7-mediated inflammation to fibrosis in congenital heart block.
21677671 2011 Upregulation of Toll-like receptors (TLRs) 6, 7, and 8 in keloid scars.
21543762 2011 Toll-like receptor 7 (TLR7)-driven accumulation of a novel CD11c? B-cell population is important for the development of autoimmunity.
21527067 2011 Expressions of Toll-like receptors 3, 4, 7, and 9 in cervical lesions and their correlation with HPV16 infection in Uighur women.
21515789 2011 Painful pathways induced by TLR stimulation of dorsal root ganglion neurons.
21458848 2011 TLR7 promotes Th1 polarization in immune thrombocytopenia.
21435390 2011 Cigarette smoke suppresses TLR-7 stimulation in response to virus infection in plasmacytoid dendritic cells.
21396113 2011 TLR7 single-nucleotide polymorphisms in the 3' untranslated region and intron 2 independently contribute to systemic lupus erythematosus in Japanese women: a case-control association study.
21354862 2011 Toll-like receptors 7 and 8 expression is associated with poor outcome and greater inflammatory response in acute ischemic stroke.
21167247 2011 Association analysis of Toll-like receptor 7 gene polymorphisms and Behçet's disease in Japanese patients.
21092001 2010 Interferon-? suppressed granulocyte colony stimulating factor production is reversed by CL097, a TLR7/8 agonist.
21061265 2011 Hodgkin disease risk: role of genetic polymorphisms and gene-gene interactions in inflammation pathway genes.
21039888 2011 TLR7 regulates dendritic cell-dependent B-cell responses through BlyS in immune thrombocytopenic purpura.
21037581 2010 Toll-like receptor 7 mediates pruritus.
20977567 2011 Polymorphism in 3'-untranslated region of toll-like receptor 4 gene is associated with protection from hepatitis B virus recurrence after liver transplantation.
20872712 2010 Toll-like receptor 7 rs179008/Gln11Leu gene variants in chronic hepatitis C virus infection.
20832340 2010 Human CD14dim monocytes patrol and sense nucleic acids and viruses via TLR7 and TLR8 receptors.
20821041 2011 TLR1/2, TLR7, and TLR9 signals directly activate human peripheral blood naive and memory B cell subsets to produce cytokines, chemokines, and hematopoietic growth factors.
20819670 2010 Expression of soluble Toll-like receptors in pleural effusions.
20733074 2010 Sex-specific association of X-linked Toll-like receptor 7 (TLR7) with male systemic lupus erythematosus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20605567 2010 Replication-independent activation of human plasmacytoid dendritic cells by the paramyxovirus SV5 Requires TLR7 and autophagy pathways.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20592251 2010 Toll-like receptor control of glucocorticoid-induced apoptosis in human plasmacytoid predendritic cells (pDCs).
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20559388 2010 TLR recognition of self nucleic acids hampers glucocorticoid activity in lupus.
20525845 2010 Association of TLR7 copy number variation with susceptibility to childhood-onset systemic lupus erythematosus in Mexican population.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20412752 2010 [Human lung cancer: role of TLR7 and TLR8 in cell survival and chemoresistance].
20410486 2010 Counterregulation between the FcepsilonRI pathway and antiviral responses in human plasmacytoid dendritic cells.
20399690 2010 Expression of Toll-like receptors 7, 8, and 9 in primary Sjögren's syndrome.
20390327 2010 Impairment of TLR7-dependent signaling in dendritic cells from chronic hepatitis C virus (HCV)-infected non-responders to interferon/ribavirin therapy.
20309865 2010 Expression of Toll-like receptor 3 and Toll-like receptor 7 in muscle is characteristic of inflammatory myopathy and is differentially regulated by Th1 and Th17 cytokines.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237413 2010 Triggering of TLR7 and TLR8 expressed by human lung cancer cells induces cell survival and chemoresistance.
20227302 2010 Polymorphisms in innate immunity genes associated with development of bronchiolitis obliterans after lung transplantation.
20194452 2010 Multiplex screening of 22 single-nucleotide polymorphisms in 7 Toll-like receptors: an association study in rheumatoid arthritis.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20124101 2010 TLR activation pathways in HIV-1-exposed seronegative individuals.
20100933 2010 Age-associated decrease in TLR function in primary human dendritic cells predicts influenza vaccine response.
20042593 2010 Cell type-specific recognition of human metapneumoviruses (HMPVs) by retinoic acid-inducible gene I (RIG-I) and TLR7 and viral interference of RIG-I ligand recognition by HMPV-B1 phosphoprotein.
20026744 2010 Human plasmacytoid dendritic cells support Th17 cell effector function in response to TLR7 ligation.
20007807 2010 Free HTLV-1 induces TLR7-dependent innate immune response and TRAIL relocalization in killer plasmacytoid dendritic cells.
19954299 2009 Increased expression of TLR7 in CD8(+) T cells leads to TLR7-mediated activation and accessory cell-dependent IFN-gamma production in HIV type 1 infection.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19924287 2009 The heterogeneous allelic repertoire of human toll-like receptor (TLR) genes.
19915052 2009 TLR2 promotes Th2/Th17 responses via TLR4 and TLR7/8 by abrogating the type I IFN amplification loop.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19887600 2009 Toll-like receptors 3 and 7 agonists enhance tumor cell lysis by human gammadelta T cells.
19841637 2010 The role of redox-dependent mechanisms in the downregulation of ligand-induced Toll-like receptors 7, 8 and 4-mediated HIF-1 alpha prolyl hydroxylation.
19821521 2010 Impaired expression and function of toll-like receptor 7 in hepatitis C virus infection in human hepatoma cells.
19794067 2009 Recognition of Borrelia burgdorferi, the Lyme disease spirochete, by TLR7 and TLR9 induces a type I IFN response by human immune cells.
19740627 2009 Cultured human melanocytes express functional toll-like receptors 2-4, 7 and 9.
19614650 2009 Toll-like receptor 4, 7 and 8 polymorphisms have no association with nonmelanoma skin cancer in renal transplant patients.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19564354 2009 Regulation of TLR7/9 responses in plasmacytoid dendritic cells by BST2 and ILT7 receptor interaction.
19553637 2009 TLR7 stimulation in human plasmacytoid dendritic cells leads to the induction of early IFN-inducible genes in the absence of type I IFN.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19473567 Investigation of TLR5 and TLR7 as candidate genes for susceptibility to systemic lupus erythematosus.
19454678 2009 Selection of molecular structure and delivery of RNA oligonucleotides to activate TLR7 versus TLR8 and to induce high amounts of IL-12p70 in primary human monocytes.
19452306 2010 Increased TLR7 expression in the adenoids among children with otitis media with effusion.
19406482 2009 Functional expression of pattern recognition receptors in tissues of the human female reproductive tract.
19381167 2009 The involvement of hypoxia-inducible factor 1 alpha in Toll-like receptor 7/8-mediated inflammatory response.
19265114 2009 Human dendritic cells stimulated via TLR7 and/or TLR8 induce the sequential production of Il-10, IFN-gamma, and IL-17A by naive CD4+ T cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19164127 2009 TLR7 and TLR8 agonists trigger different signaling pathways for human dendritic cell maturation.
19129482 2009 Role of atopic status in Toll-like receptor (TLR)7- and TLR9-mediated activation of human eosinophils.
19120473 2009 Regulatory molecules required for nucleotide-sensing Toll-like receptors.
19114863 2009 A frequent functional toll-like receptor 7 polymorphism is associated with accelerated HIV-1 disease progression.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18995892 2009 Toll-like receptor 7-induced naive human B-cell differentiation and immunoglobulin production.
18949362 2008 Up-regulation of NK cell function against head and neck cancer in response to ss-isRNA requires TLR7.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18806803 2008 Divergent TLR7 and TLR9 signaling and type I interferon production distinguish pathogenic and nonpathogenic AIDS virus infections.
18686608 2008 [Expression of toll-like receptors in human epidermal keratinocytes].
18682521 2008 Association analysis identifies TLR7 and TLR8 as novel risk genes in asthma and related disorders.
18596825 2009 Imiquimod, a Toll-like receptor 7 agonist, inhibits melanogenesis and proliferation of human melanocytes.
18535206 2008 CD300a/c regulate type I interferon and TNF-alpha secretion by human plasmacytoid dendritic cells stimulated with TLR7 and TLR9 ligands.
18474259 2008 Stimulation of iNOS expression and apoptosis resistance in B-cell chronic lymphocytic leukemia (B-CLL) cells through engagement of Toll-like receptor 7 (TLR-7) and NF-kappaB activation.
18438411 2008 Sequential control of Toll-like receptor-dependent responses by IRAK1 and IRAK2.
18431484 2008 Anti-HIV activity mediated by natural killer and CD8+ cells after toll-like receptor 7/8 triggering.
18406377 2008 Recognition of nucleic acid and nucleic acid analogs by Toll-like receptors 7, 8 and 9.
18394314 Toll-like receptors.
18385087 2008 Toll-like receptor polymorphisms and age-related macular degeneration.
18250417 2008 TLR7 is involved in sequence-specific sensing of single-stranded RNAs in human macrophages.
18215354 2008 Toll-like receptor 7 and 9 expression in peripheral blood mononuclear cells from patients with chronic hepatitis B and related hepatocellular carcinoma.
18088248 2008 Association of TLR7 single nucleotide polymorphisms with chronic HCV-infection and response to interferon-a-based therapy.
18021446 2007 Differential expression of viral PAMP receptors mRNA in peripheral blood of patients with chronic hepatitis C infection.
17964520 2007 Genetic polymorphisms of viral infection-associated Toll-like receptors in Chinese population.
17956986 2007 HIV turns plasmacytoid dendritic cells (pDC) into TRAIL-expressing killer pDC and down-regulates HIV coreceptors by Toll-like receptor 7-induced IFN-alpha.
17907191 2007 Variation in the relative copy number of the TLR7 gene in patients with systemic lupus erythematosus and healthy control subjects.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17698957 2007 Stabilized immune modulatory RNA compounds as agonists of Toll-like receptors 7 and 8.
17609264 2007 Manipulation of the toll-like receptor 7 signaling pathway by Epstein-Barr virus.
17608805 2007 The bacterium, nontypeable Haemophilus influenzae, enhances host antiviral response by inducing Toll-like receptor 7 expression: evidence for negative regulation of host anti-viral response by CYLD.
17512627 2007 A Toll-like receptor 7 single nucleotide polymorphism protects from advanced inflammation and fibrosis in male patients with chronic HCV-infection.
17371961 2007 Natural and synthetic TLR7 ligands inhibit CpG-A- and CpG-C-oligodeoxynucleotide-induced IFN-alpha production.
17301562 2007 Polymorphisms in Toll-like receptor 9 influence the clinical course of HIV-1 infection.
17075576 2007 Expression of toll-like receptors and type 1 interferon specific protein MxA in biliary atresia.
17040905 2006 The functional effects of physical interactions among Toll-like receptors 7, 8, and 9.
17023556 2007 TLR7/8 agonists impair monocyte-derived dendritic cell differentiation and maturation.
16973388 2006 Toll-like receptor 7-dependent loss of B cell tolerance in pathogenic autoantibody knockin mice.
16935934 2006 Cooperative molecular and cellular networks regulate Toll-like receptor-dependent inflammatory responses.
16887967 2006 TLR7 ligands induce higher IFN-alpha production in females.
16623926 2006 In vitro-generated viral double-stranded RNA in contrast to polyinosinic:polycytidylic acid induces interferon-alpha in human plasmacytoid dendritic cells.
16517754 2006 Sensitization of IL-2 signaling through TLR-7 enhances B lymphoma cell immunogenicity.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16446426 2006 Activation of anti-hepatitis C virus responses via Toll-like receptor 7.
16286015 2005 Human TLR-7-, -8-, and -9-mediated induction of IFN-alpha/beta and -lambda Is IRAK-4 dependent and redundant for protective immunity to viruses.
16230478 2005 Nucleic acids of mammalian origin can act as endogenous ligands for Toll-like receptors and may promote systemic lupus erythematosus.
16188996 2005 Activation of innate defense against a paramyxovirus is mediated by RIG-I and TLR7 and TLR8 in a cell-type-specific manner.
16116638 2005 Isatoribine, an agonist of TLR7, reduces plasma virus concentration in chronic hepatitis C infection.
16111635 2005 Suppression of RNA recognition by Toll-like receptors: the impact of nucleoside modification and the evolutionary origin of RNA.
16025564 2005 TLR8 and TLR7 are involved in the host's immune response to human parechovirus 1.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15778362 2005 Plasmacytoid dendritic cells control TLR7 sensitivity of naive B cells via type I IFN.
15695821 2005 The interferon regulatory factor, IRF5, is a central mediator of toll-like receptor 7 signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032557 2002 Human TLR7 or TLR8 independently confer responsiveness to the antiviral compound R-848.
11970999 2002 Quantitative expression of toll-like receptor 1-10 mRNA in cellular subsets of human peripheral blood mononuclear cells and sensitivity to CpG oligodeoxynucleotides.
11909637 2002 Toll-like receptors as adjuvant receptors.
11782555 2002 Toll-like receptors.
11022120 2000 Cloning and characterization of a sub-family of human toll-like receptors: hTLR7, hTLR8 and hTLR9.
11022119 2000 Three novel mammalian toll-like receptors: gene structure, expression, and evolution.
9435236 1998 A family of human receptors structurally related to Drosophila Toll.