Property Summary

Ligand Count 47
NCBI Gene PubMed Count 282
PubMed Score 1078.42
PubTator Score 545.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Dermatitis, Allergic Contact 67 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.5e-06
cutaneous lupus erythematosus 3.800 1.3e-04
gastric cancer 1.200 1.2e-02
glioblastoma 1.400 2.5e-02
group 3 medulloblastoma -1.100 2.0e-03
hepatocellular carcinoma 1.800 7.2e-05
lung cancer -1.200 9.1e-03
lung carcinoma -1.400 3.4e-14
medulloblastoma, large-cell -1.500 2.2e-04
non-small cell lung cancer -1.003 1.1e-08
osteosarcoma -1.705 3.0e-02
ovarian cancer -1.900 4.1e-05
pancreatic cancer 1.300 1.4e-02
pancreatic carcinoma 1.300 1.4e-02
primary Sjogren syndrome 1.700 2.2e-04
tuberculosis 1.800 3.7e-03

Gene RIF (269)

AA Sequence

MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNL      1 - 70
TLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLL     71 - 140
EIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLS    141 - 210
LKDNNVTAVPTVLPSTLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQ    211 - 280
IPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFN    281 - 350
FELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF    351 - 420
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNKEASFMSVNES    421 - 490
CYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHST    491 - 560
AFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNH    561 - 630
LDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKN    631 - 700
LETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPEN    701 - 770
VLNNLKMLLLHHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL    771 - 840
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLA    841 - 910
ELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMD    911 - 980
EKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV     981 - 1049
//

Text Mined References (282)

PMID Year Title