Property Summary

NCBI Gene PubMed Count 140
PubMed Score 120.50
PubTator Score 103.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
lung carcinoma 2844 2.1e-24

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.700 2.1e-24

Protein-protein Interaction (5)

Gene RIF (129)

PMID Text
26741133 TLR7 rs179008 showed some associations with post-bronchiolitis lung function deficiency, and polymorphisms of TLR4 rs4986790, and TLR6 rs5743810 in particular, with airway reactivity.
26621243 genetic polymorphism is associated with malaria disease progression in Indian patients
26548862 Study showed that MyD88 Toll/interleukin-1 receptor (TIR) domain interacted with TLR5TIR but not with TLR6TIR. The solubility of both TLR5TIR and TLR6TIR were influenced by its binding partner MyD88TIR.
26470427 Frequencies of TLR1-TLR6 two-locus haplotypes in major populations of South Urals were determined for the first time
26347747 Exposure of the TLR2 transgene cell line, HEK293-TLR2/6, to HIV-1 CA (p24) increases IL-8 production BUT NOT in the TLR2 transgene cell lines, TZM-bl-2 and HEK293-TLR2/1
26312625 Study annotated variants at 4p14 as expression quantitative trait loci (eQTL) associated with TLR6/10 and FAM114A1; findings suggest that 4p14 polymorphisms are linked to host immune response to H. pylori infection but not to its acquisition.
26226614 Dengue virus NS1 protein is the viral protein responsible for the activation of TLR2 and TLR6 during Dengue virus infection
25850295 The correlation between TLR1, TLR6, and TLR10 polymorphisms and the development of atopic dermatitis in the Republic of Bashkortostan has been found.
25765738 A novel mechanism for inducing CXCL10 production directly from melanoma cells, with TLR2/6 agonists +IFNgamma.
25741726 TLR6 instructs specific classes of dendrites in the synapses of the olfactory circuit in transgenic Drosophila.
25605403 C745T genotype associated with elevated risk of Bacillus Calmette-Guerin osteitis following infant vaccination
25604476 OSA patients had increased TLR2/6 co-expressions on blood immune cells, which were related to their immune cell counts and could be reversed with CPAP treatment. In vitro IHR could induce TLR2/6 co-upregulation.
25549591 expression is increased in both maternal part and fetal part of the placenta in Iranian women with preeclampsia
25431887 Transmembrane oligomeric form of Vibrio cholerae cytolysin (VCC) triggers TLR2/TLR6-dependent proinflammatory responses in monocytes and macrophages.
25423559 Suggest genetic polymorphisms in TLR3/6 may have a plausible role in the occurrence of severe acute pancreatitis.
25261617 SNPs in the exons of TLR1 and TLR6 are associated with susceptibility to type 1 diabetes in the Chinese population.
25253287 Data show that a total of nine single-nucleotide polymorphisms (SNPs) in TLR1, TLR4, TLR6 and TLR8 in Caucasians, and two other SNPs, one each in Toll-like receptors TLR4 and TLR8, in African Americans were significantly associated with HIV status.
25213166 study found TLR6 gene rs3775073 polymorphism may be associated with 2-fold decrease of infective endocarditis risk
25121610 Exposure of the TLR2 transgene cell line, HEK293-TLR2/6, to HIV-1 CA (p24) increases IL-8 production BUT NOT in the TLR2 transgene cell lines, TZM-bl-2 and HEK293-TLR2/1
25088687 this study reports the first crystal structure of the TIR domain of TLR6 at 2.2 A resolution.
25028161 Genetic variation rs5743565 in TLR1 might be associated with the decreased susceptibility to Graves disease, whlie polymorphisms in TLR6 and TLR10 did not reach the statistical significance.
24984237 No association was observed for either TLR1 1805 T>G or TLR6 745 C>T polymorphism and pulmonary tuberculosis.
24922103 TLR6 (a C-->T mutation at position 745) polymorphism is associated with an increased risk of both laboratory- and clinically-defined neurosyphilis.
24797996 these data indicated that TLR6 V327M may be involved in mediating deleterious inflammatory responses and modulating host susceptibility to Klebsiella pneumonia.
24689870 Under treatment with MMC and hydrostatic pressure, UC cells showed increasing apoptosis using extrinsic pathways through upregulation of TLR6 and CTGF
24612386 TLR2 and its co-receptors, TLR1 and TLR6, contribute to the pathogenicity of aPLA; aPLA are internalized via clathrin- and CD14-dependent endocytosis; and endocytosis is required for NF-kappaB activation
24511099 In the genetic association analysis, polymorphisms in TLR1 (S248N and R80T), TLR2 (P631H), and TLR6 (P249S) were associated with an increased susceptibility to complicated skin and skin structure infections.
24445834 Authors demonstrated that TLR1 rs5743618 was associated with asthma and atopic eczema during the first 6 years of life after early bronchiolitis and TLR6 rs5743810 was associated with present atopy at preschool age.
24162774 Exposure of the TLR2 transgene cell line, HEK293-TLR2/6, to HIV-1 CA (p24) increases IL-8 production BUT NOT in the TLR2 transgene cell lines, TZM-bl-2 and HEK293-TLR2/1
24112285 C745T polymorphism not associated with severity of bronchiolitis or risk of postbronchiolitis wheezing
23823019 TLR6 variant, 359T>C, is an independent risk factor for Legionnaire disease.
23626692 The 663leucine and 688aspragine residues outside of the BB loop are essential for the responsiveness of TLR2/2, TLR2/1 and TLR2/6, but the 681proline residue inside of the BB loop exhibits divergent roles in TLR2/2, TLR2/1 and TLR2/6 signal transduction.
23593431 Cell activation by Ureaplasma parvum and urealyticum seem to require lipid raft function and formation of heterotypic receptor complexes comprising of TLR2 and TLR6 on the cell surface and TLR9 intracellularly.
23518821 Studied association between single nucleotide polymorphism in toll-like receptor 6 and a decreased risk for ureaplasma respiratory tract colonization and bronchopulmonary dysplasia in preterm infants.
23255565 Women who carried the TLR6 variant were less likely to have upper genital tract infection and inflammation.
23151486 The study shows that genetic variation within the TLR10/1/6 locus is the major common genetic factor explaining interindividual variation in TLR1/2-mediated cytokine responses.
22992740 Data indicate that R753Q TLR2 showed impaired tyrosine phosphorylation, dimerization with TLR6 and MyD88 recruitment.
22703024 The results showed that the genetic markers in TLR1, TLR4, TLR5 TLR6, and TLR10 were associated with the occurrence of acute Graft-versus-host disease following hematopoietic stem cell transplantation
22280448 Women with microbial invasion of the amniotic cavity and histological chorioamniotis had higher amniotic fluid sTLR1, 2 and 6 levels.
22219617 No TLR6 polymorphisms were detected in Korean subjects.
22150367 absence of the common haplotype in the TLR10-TLR1-TLR6 gene cluster increases the risk of developing chronic disease in patients already affected by sarcoidosis.
22134717 Single nucleotide polymorphisms in TLR6 gene is associated with the inverse association between childhood acute lymphoblastic leukemia and atopic disease.
22030478 study showed that coactivation of TLR4 and TLR2/6 coordinates an additive augmentation of IL-6 gene transcription via p38MAPK pathway in U937 mononuclear cells
21852947 TLR1/6 polymorphisms modulate TH1 T-cell polarization through genetic regulation of monocyte IL-10 secretion in the absence of IL-12.
21813774 our data indicated a critical role for TLR6-dependent signaling in Mycobacterium leprae-Schwann cell interactions
21677671 Toll-like receptors (TLRs) 6, 7, and 8 are upregulated in keloid scars
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20815312 genetic polymorphism association with allergic rhinitis in asthma in a Chinese population
20815312 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20797905 Observational study of gene-disease association. (HuGE Navigator)
20713893 A novel mechanism of lipoteichoic acid (LTA)-induced cytokine induction in human peripheral blood cells involves uptake of LTA and subsequent intracellular recognition driven by TLR2, TLR6, and CD14.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20616560 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20595247 The rs5743810 polymorphism of TLR6 may be involved in development of anti-interferon-beta antibodies in males, although further studies are required to firmly establish this.
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20554749 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20445564 These studies provide new insight into the role of TLR6 variation and the innate immune response to human infection.
20445564 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20402822 In 191 in Chinese Cantonese persons, 7 single nucleotide polymorphisms were detected. Comparing these with the NCBI dbSNP database, 2 new SNPs (+176T/C & +1408G/T) & 5 SNPs causing amino-acid substitutions were reported.
20402822 Observational study of genotype prevalence. (HuGE Navigator)
20348427 TLR10 is most related to TLR1 and TLR6, both of which independently cooperate with TLR2 in the sensing of a variety of microbial and fungal components; TLR10 shares a number of microbial agonists with TLR1, but not TLR6, and uses TLR2 as a coreceptor.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227302 Observational study of gene-disease association. (HuGE Navigator)
20224557 These data suggest that hypertensive women homozygous for the TLR6 249Ser polymorphism might exhibit lower left ventricular wall thickness and reduced TLR6-mediated inflammatory response than females carrying the major allele.
20224557 Observational study of gene-disease association. (HuGE Navigator)
20207250 Observational study of gene-disease association. (HuGE Navigator)
20200442 Common germ line genetic variation in TLR4 and TLR6-1-10 did not seem to have a strong association with risk of prostate cancer
20200442 Observational study of gene-disease association. (HuGE Navigator)
20100933 Studies show substantial decreases in older compared with young individuals in cytokine production in response to TLR1/2, TLR6, TLR3, TLR5, and TLR8, TLR7 and TLR9 in DCs.
20056792 results clearly identified a TLR2/6-dependent induction of angiogenesis by the bacterial lipopeptide MALP-2, which is mediated by GM-CSF
20037584 Our results identify CD36-TLR4-TLR6 activation as a common molecular mechanism by which atherogenic lipids and amyloid-beta stimulate sterile inflammation
19773279 Observational study of gene-disease association. (HuGE Navigator)
19771452 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19543401 Observational study of gene-disease association. (HuGE Navigator)
19543380 Analyses of the cytokine production profile of macrophages isolated from knockout mice deficient in TLRs or in MyD88 and TRIF revealed a critical role for TLR2, TLR6 and MyD88 in the production of IFNbeta-independent chemokines.
19505919 Observational study of gene-disease association. (HuGE Navigator)
19458089 Wolbachia lipoprotein stimulates innate and adaptive immunity through Toll-like receptors 2 and 6 to induce disease manifestations of filariasis
19423540 Observational study of gene-disease association. (HuGE Navigator)
19378782 plays a role in innate and adaptive immune responses. (review)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254290 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19200604 Observational study of gene-disease association. (HuGE Navigator)
19172872 infection of cells expressing toll-like receptors TLR2/6 with mycoplasma M. arginini leaded to suppression of apoptosis induced by chemotherapeutic agents (cisplatin, 5-fluorouracil, taxol).
19029192 Meta-analysis of gene-disease association. (HuGE Navigator)
18776592 Observational study of gene-disease association. (HuGE Navigator)
18752252 common haplotype in the TLR10-TLR1-TLR6 gene cluster influences prostate cancer risk and clearly supports the need for further investigation of TLR genes in other populations
18752252 Observational study of gene-disease association. (HuGE Navigator)
18686608 Human epidermal keratinocytes constitutively express all TLR 1-10 mRNA, which may enable human keratinocytes to respond to a wide range of pathogenic micro-organisms.
18547625 These results suggest that functional relevant TLR1 and TLR6 variants are directly involved in asthma development.
18547625 Observational study of gene-disease association. (HuGE Navigator)
18451040 The lipoproteins from U. parvum were found to activate NF-kappaB through TLR1, TLR2 and TLR6.
18424724 TLR6 may be a key factor in determining whether the response to PDG would be apoptosis or inflammation.
18325643 Observational study of gene-disease association. (HuGE Navigator)
18159247 studies reveal coordinated induction of TLR2 and TLR6 during hypoxia and suggest tissue hypoxia in transcriptional adaptation of innate immune responses during acute infection or inflammation
18091991 Observational study of gene-disease association. (HuGE Navigator)
18056480 Heterodimerization of TLR2 with TLR1 or TLR6 evolutionarily has developed to expand the ligand spectrum to enable the innate immune system to recognize the numerous, different structures of various bacterial lipopolysaccharides.
17934735 The mean frequency of TLR-6 (toll-like receptor 6) expressing granulocytes in Behecets disease patients was significantly lower than in controls
17932345 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17932345 No effect modification was observed for age, body mass index, or family history of prostate cancer, except that TLR6_3649 showed nominally significant interaction with family history at the P < 0.05 level.
17827388 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17651447 data suggest that TLR2/6 heterodimers are responsible for sensing Bacillus anthracis cell wall and PA, whereas the formation of the subsequent toxin (LF + PA) seems to evade detection by the innate immune system contributing to the virulence of the toxin.
17595233 Observational study of gene-disease association. (HuGE Navigator)
16880211 TLR-2/6 and TLR2/1 heterodimer sorting at the cell surface determines heterotypic associations with CD36 and intracellular targeting
16648973 TLR6 plays an important role in the regulation of the apoptosis of PMNs. Changes in the expression of TLR6 and inhibition of apoptosis of PMNs by rhIL-18 confirm the vital role this receptor and of rhIL-18 in regulating the survival of these cells.
16537705 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16461792 Observational study of gene-disease association. (HuGE Navigator)
16461792 The presence of both TLR1 743A > G (Asn248 > Ser) and TLR6 745C > T (Ser249 > Pro) single nucleotide polymorphisms is associated with invasive aspergillosis following allogeneic stem cell transplantation.
16374251 Observational study of gene-disease association. (HuGE Navigator)
16188043 Observational study of gene-disease association. (HuGE Navigator)
16188043 A Ser249Pro polymorphism in TLR6 might play a role in the pathogenesis of childhood asthma.
16177110 Subunit b of F0F1 type ATPase from Mycoplasma pneumoniae activates NF-kappaB through human TLR1, TLR2, and TLR6
16081826 Observational study of gene-disease association. (HuGE Navigator)
15812078 Observational study of gene-disease association. (HuGE Navigator)
15812078 The observed multiple associated SNPs at the TLR6-TLR1-TLR10 gene cluster were dependent and suggest the presence of a founder prostate cancer risk variant on this haplotype background.
15661917 A function-blocking monoclonal antibody study reveals that human TLR6 recognizes diacylated lipopeptide MALP-2 and peptidoglycan at the monocyte cell surface cooperatively with human TLR2 receptor.
15266299 Observational study of gene-disease association. (HuGE Navigator)
14966134 Toll-like receptor 2 dimerized with Toll-like receptor 6 or 1 is activated by saturated fatty acid and inhibited by polyunsaturated fatty acid
14706104 stimulation by Mycoplasma fermentans lipoproteins mediates NF-kappa B activation as an early event and apoptosis as a later event in HEK293 cells

AA Sequence

MTKDKEPIVKSFHFVCLMIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVS      1 - 70
DMSFLSELTVLRLSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRHLDLSFNDFKALPICK     71 - 140
EFGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFA    141 - 210
IQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEY    211 - 280
LNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPH    281 - 350
APSTFKFLNFTQNVFTDSIFEKCSTLVKLETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRH    351 - 420
KENCTWVESIVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPG    421 - 490
CGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELREFVKNIDQVSSEVLEGWPDSYK    491 - 560
CDYPESYRGSPLKDFHMSELSCNITLLIVTIGATMLVLAVTVTSLCIYLDLPWYLRMVCQWTQTRRRARN    561 - 630
IPLEELQRNLQFHAFISYSEHDSAWVKSELVPYLEKEDIQICLHERNFVPGKSIVENIINCIEKSYKSIF    631 - 700
VLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKR    701 - 770
GLFWANIRAAFNMKLTLVTENNDVKS                                                771 - 796
//

Text Mined References (143)

PMID Year Title
26741133 2016 Gene Polymorphism of Toll-Like Receptors and Lung Function at Five to Seven Years of Age after Infant Bronchiolitis.
26621243 2016 Genetic predisposition of variants in TLR2 and its co-receptors to severe malaria in Odisha, India.
26548862 2016 In Vitro Reconstitution of the Toll/Interleukin-1 Receptor (TIR) Domain Complex Between TLR5/6 and Myd88.
26470427 [DISTRIBUTION OF TWO-LOCUS HAPLOTYPES OF MICROBIAL COMPONENT SENSOR GENES TLR1 AND TLR6 IN MAJOR POPULATIONS OF SOUTH URALS].
26312625 2015 Association of 4p14 TLR locus with antibodies to Helicobacter pylori.
26226614 2015 Activation of TLR2 and TLR6 by Dengue NS1 Protein and Its Implications in the Immunopathogenesis of Dengue Virus Infection.
25850295 [Association of polymorphisms in toll-like receptor genes with atopic dermatitis in the Republic of Bashkortostan].
25765738 2015 TLR2/6 agonists and interferon-gamma induce human melanoma cells to produce CXCL10.
25741726 2015 Toll receptors instruct axon and dendrite targeting and participate in synaptic partner matching in a Drosophila olfactory circuit.
25605403 2015 Toll-like receptor 2 subfamily gene polymorphisms are associated with Bacillus Calmette-Guérin osteitis following newborn vaccination.
25604476 2015 Co-upregulation of Toll-like receptors 2 and 6 on peripheral blood cells in patients with obstructive sleep apnea.
25549591 2014 Differences in the expression of TLRs and inflammatory cytokines in pre-eclamptic compared with healthy pregnant women.
25431887 2015 Transmembrane oligomeric form of Vibrio cholerae cytolysin triggers TLR2/TLR6-dependent proinflammatory responses in monocytes and macrophages.
25423559 2015 The role of Toll-like receptor polymorphisms in acute pancreatitis occurrence and severity.
25261617 2014 SNPs in the exons of Toll-like receptors are associated with susceptibility to type 1 diabetes in Chinese population.
25253287 2014 Association of Toll-like receptor polymorphisms with HIV status in North Americans.
25213166 2015 An association between single nucleotide polymorphisms within TLR and TREM-1 genes and infective endocarditis.
25088687 2014 Crystal structure of TIR domain of TLR6 reveals novel dimeric interface of TIR-TIR interaction for toll-like receptor signaling pathway.
25028161 2015 Polymorphisms in TLR1, TLR6 and TLR10 genes and the risk of Graves' disease.
24984237 2014 Toll-like Receptor 1 743 A>G, 1805 T>G & Toll-like Receptor 6 745 C>T gene polymorphism and tuberculosis: a case control study of north Indian population from Agra (India).
24922103 2014 Toll-like receptor polymorphisms are associated with increased neurosyphilis risk.
24797996 2014 Toll-like receptor 6 V327M polymorphism is associated with an increased risk of Klebsiella pneumoniae infection.
24689870 2014 Toll-like receptor 6 and connective tissue growth factor are significantly upregulated in mitomycin-C-treated urothelial carcinoma cells under hydrostatic pressure stimulation.
24612386 2014 NF-?B is activated from endosomal compartments in antiphospholipid antibodies-treated human monocytes.
24511099 2014 TLR1, TLR2, and TLR6 gene polymorphisms are associated with increased susceptibility to complicated skin and skin structure infections.
24445834 2014 The association of genetic variants in toll-like receptor 2 subfamily with allergy and asthma after hospitalization for bronchiolitis in infancy.
24112285 2013 Toll-like receptor 2 subfamily genotypes are not associated with severity of bronchiolitis or postbronchiolitis wheezing in infants.
23823019 2013 A TLR6 polymorphism is associated with increased risk of Legionnaires' disease.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23652523 2013 Identification of genetic loci associated with Helicobacter pylori serologic status.
23626692 2013 Divergent roles of amino acid residues inside and outside the BB loop affect human Toll-like receptor (TLR)2/2, TLR2/1 and TLR2/6 responsiveness.
23593431 2013 Synergic activation of toll-like receptor (TLR) 2/6 and 9 in response to Ureaplasma parvum & urealyticum in human amniotic epithelial cells.
23518821 2013 Single nucleotide polymorphism in toll-like receptor 6 is associated with a decreased risk for ureaplasma respiratory tract colonization and bronchopulmonary dysplasia in preterm infants.
23255565 2013 Racial variation in toll-like receptor variants among women with pelvic inflammatory disease.
23151486 2013 Variation in the TLR10/TLR1/TLR6 locus is the major genetic determinant of interindividual difference in TLR1/2-mediated responses.
22992740 2012 R753Q polymorphism inhibits Toll-like receptor (TLR) 2 tyrosine phosphorylation, dimerization with TLR6, and recruitment of myeloid differentiation primary response protein 88.
22703024 2012 Toll-like receptor gene polymorphisms confer susceptibility to graft-versus-host disease in allogenic hematopoietic stem cell transplantation.
22280448 2012 Soluble Toll-like receptor 1 family members in the amniotic fluid of women with preterm prelabor rupture of the membranes.
22219617 2012 Association between toll-like receptors/CD14 gene polymorphisms and inflammatory bowel disease in Korean population.
22150367 2012 Genetic variation in the Toll-like receptor gene cluster (TLR10-TLR1-TLR6) influences disease course in sarcoidosis.
22134717 2012 Polymorphisms in the TLR6 gene associated with the inverse association between childhood acute lymphoblastic leukemia and atopic disease.
22030478 2011 Coactivation of TLR4 and TLR2/6 coordinates an additive augmentation on IL-6 gene transcription via p38MAPK pathway in U937 mononuclear cells.
21852947 2011 Association of human TLR1 and TLR6 deficiency with altered immune responses to BCG vaccination in South African infants.
21813774 2011 TLR6-driven lipid droplets in Mycobacterium leprae-infected Schwann cells: immunoinflammatory platforms associated with bacterial persistence.
21677671 2011 Upregulation of Toll-like receptors (TLRs) 6, 7, and 8 in keloid scars.
21618349 2011 Functional characterization of naturally occurring genetic variants in the human TLR1-2-6 gene family.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20815312 2010 Polymorphisms in the toll-like receptor 2 subfamily and risk of asthma: a case-control analysis in a Chinese population.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20797905 2010 Toll-like receptor and TIRAP gene polymorphisms in pulmonary tuberculosis patients of South India.
20713893 2010 Internalization and coreceptor expression are critical for TLR2-mediated recognition of lipoteichoic acid in human peripheral blood.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20616560 2010 Genetic differences between five European populations.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20554749 2010 FGFR2 and other loci identified in genome-wide association studies are associated with breast cancer in African-American and younger women.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20445564 2010 Single nucleotide polymorphisms in toll-like receptor 6 are associated with altered lipopeptide- and mycobacteria-induced interleukin-6 secretion.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20402822 2010 Single nucleotide polymorphisms and haplotypes of TLR6 gene in Chinese Cantonese population.
20348427 2010 Human TLRs 10 and 1 share common mechanisms of innate immune sensing but not signaling.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227302 2010 Polymorphisms in innate immunity genes associated with development of bronchiolitis obliterans after lung transplantation.
20224557 2010 Toll-like receptor 6 Ser249Pro polymorphism is associated with lower left ventricular wall thickness and inflammatory response in hypertensive women.
20207250 2010 The association of innate immune response gene polymorphisms and puerperal group A streptococcal sepsis.
20200442 2010 Sequence variants in the TLR4 and TLR6-1-10 genes and prostate cancer risk. Results based on pooled analysis from three independent studies.
20100933 2010 Age-associated decrease in TLR function in primary human dendritic cells predicts influenza vaccine response.
20056792 2010 Toll-like receptor 2/6 stimulation promotes angiogenesis via GM-CSF as a potential strategy for immune defense and tissue regeneration.
20037584 2010 CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.
19931471 2009 Recognition of lipopeptide patterns by Toll-like receptor 2-Toll-like receptor 6 heterodimer.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19771452 2010 Variants in toll-like receptors 2 and 9 influence susceptibility to pulmonary tuberculosis in Caucasians, African-Americans, and West Africans.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19543401 2009 Toll-like receptor polymorphisms and susceptibility to urinary tract infections in adult women.
19543380 2009 Innate immune sensing of modified vaccinia virus Ankara (MVA) is mediated by TLR2-TLR6, MDA-5 and the NALP3 inflammasome.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19458089 2009 Wolbachia lipoprotein stimulates innate and adaptive immunity through Toll-like receptors 2 and 6 to induce disease manifestations of filariasis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19378782 2009 [Role of Toll-like receptors in innate and adaptive immune responses].
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254290 2009 Polymorphisms in interleukin-1 receptor-associated kinase 4 are associated with total serum IgE.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19200604 2009 Gene polymorphisms of Toll-like and related recognition receptors in relation to the vaginal carriage of Gardnerella vaginalis and Atopobium vaginae.
19172872 2008 [Mycoplasma M. arginini infection induces constitutive activation of NF-kappaB and inhibits apoptosis in cells expressing toll-like receptors TLR2/6].
19029192 2009 A pooled investigation of Toll-like receptor gene variants and risk of non-Hodgkin lymphoma.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18776592 2008 Polymorphisms of toll like receptors in the genetics of severe RSV associated diseases.
18752252 2008 Genetic variation in the toll-like receptor gene cluster (TLR10-TLR1-TLR6) and prostate cancer risk.
18686608 2008 [Expression of toll-like receptors in human epidermal keratinocytes].
18547625 2008 Toll-like receptor heterodimer variants protect from childhood asthma.
18451040 2008 Ureaplasma parvum lipoproteins, including MB antigen, activate NF-{kappa}B through TLR1, TLR2 and TLR6.
18424724 2008 TLR6 modulates first trimester trophoblast responses to peptidoglycan.
18394314 Toll-like receptors.
18325643 2008 Associations between SNPs in toll-like receptors and related intracellular signaling molecules and immune responses to measles vaccine: preliminary results.
18159247 2007 Hypoxia inducible factor (HIF)-1 coordinates induction of Toll-like receptors TLR2 and TLR6 during hypoxia.
18091991 2007 Full-exon resequencing reveals toll-like receptor variants contribute to human susceptibility to tuberculosis disease.
18056480 2008 Heterodimerization of TLR2 with TLR1 or TLR6 expands the ligand spectrum but does not lead to differential signaling.
17934735 2008 Differential expression of toll-like receptor 6 on granulocytes and monocytes implicates the role of microorganisms in Behcet's disease etiopathogenesis.
17932345 2007 Association between Toll-like receptor gene cluster (TLR6, TLR1, and TLR10) and prostate cancer.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17651447 2007 Anthrax toxin evades Toll-like receptor recognition, whereas its cell wall components trigger activation via TLR2/6 heterodimers.
17595233 2007 Mutations in pattern recognition receptor genes modulate seroreactivity to microbial antigens in patients with inflammatory bowel disease.
16880211 2006 Membrane sorting of toll-like receptor (TLR)-2/6 and TLR2/1 heterodimers at the cell surface determines heterotypic associations with CD36 and intracellular targeting.
16648973 Toll-like receptors types 2 and 6 and the apoptotic process in human neutrophils.
16537705 2006 Interactions of sequence variants in interleukin-1 receptor-associated kinase4 and the toll-like receptor 6-1-10 gene cluster increase prostate cancer risk.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16461792 2005 TLR1 and TLR6 polymorphisms are associated with susceptibility to invasive aspergillosis after allogeneic stem cell transplantation.
16374251 2006 Toll-like receptor-1, -2, and -6 polymorphisms influence disease extension in inflammatory bowel diseases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16188043 2005 Evaluation of the toll-like receptor 6 Ser249Pro polymorphism in patients with asthma, atopic dermatitis and chronic obstructive pulmonary disease.
16177110 2005 A dipalmitoylated lipoprotein from Mycoplasma pneumoniae activates NF-kappa B through TLR1, TLR2, and TLR6.
16081826 2005 Heterozygous Arg753Gln polymorphism of human TLR-2 impairs immune activation by Borrelia burgdorferi and protects from late stage Lyme disease.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15812078 2005 Sequence variants in Toll-like receptor gene cluster (TLR6-TLR1-TLR10) and prostate cancer risk.
15661917 2005 Surface-expressed TLR6 participates in the recognition of diacylated lipopeptide and peptidoglycan in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15266299 2004 Toll-like receptor 6 gene (TLR6): single-nucleotide polymorphism frequencies and preliminary association with the diagnosis of asthma.
14966134 2004 Saturated fatty acid activates but polyunsaturated fatty acid inhibits Toll-like receptor 2 dimerized with Toll-like receptor 6 or 1.
14706104 2004 Stimulation of human Toll-like receptor (TLR) 2 and TLR6 with membrane lipoproteins of Mycoplasma fermentans induces apoptotic cell death after NF-kappa B activation.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
12724322 2003 Bruton's tyrosine kinase is a Toll/interleukin-1 receptor domain-binding protein that participates in nuclear factor kappaB activation by Toll-like receptor 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077222 2002 Cutting edge: role of Toll-like receptor 1 in mediating immune response to microbial lipoproteins.
11970999 2002 Quantitative expression of toll-like receptor 1-10 mRNA in cellular subsets of human peripheral blood mononuclear cells and sensitivity to CpG oligodeoxynucleotides.
11782555 2002 Toll-like receptors.
11686851 2001 Macrophages exposed continuously to lipopolysaccharide and other agonists that act via toll-like receptors exhibit a sustained and additive activation state.
11607792 2001 IFNs activate toll-like receptor gene expression in viral infections.
11561001 2001 Subsets of human dendritic cell precursors express different toll-like receptors and respond to different microbial antigens.
11441107 2001 Cooperation of Toll-like receptor 2 and 6 for cellular activation by soluble tuberculosis factor and Borrelia burgdorferi outer surface protein A lipoprotein: role of Toll-interacting protein and IL-1 receptor signaling molecules in Toll-like receptor 2 signaling.
11431423 2001 Discrimination of bacterial lipoproteins by Toll-like receptor 6.
11123271 2001 Cutting edge: functional interactions between toll-like receptor (TLR) 2 and TLR1 or TLR6 in response to phenol-soluble modulin.
11095740 2000 The repertoire for pattern recognition of pathogens by the innate immune system is defined by cooperation between toll-like receptors.
11081518 2000 Structural basis for signal transduction by the Toll/interleukin-1 receptor domains.
10426995 1999 Host defense mechanisms triggered by microbial lipoproteins through toll-like receptors.
10231569 1999 TLR6: A novel member of an expanding toll-like receptor family.
9435236 1998 A family of human receptors structurally related to Drosophila Toll.