1. Home
  2. Targets
  3. transcription factor
  4. transcription cofactor
  5. Transducin-like enhancer protein 4

Tbio Transducin-like enhancer protein 4

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Essential for the transcriptional repressor activity of SIX3 during retina and lens development and for SIX3 transcriptional auto-repression (By similarity).

 Comments

Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.82
PubTator Score 23.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 2.100 2.3e-02
chronic lymphosyte leukemia 1.100 2.3e-04
cystic fibrosis -1.276 3.1e-03
atypical teratoid / rhabdoid tumor 1.400 8.3e-03
glioblastoma 1.300 1.7e-02
primitive neuroectodermal tumor 1.200 1.7e-02
lung cancer -1.700 1.3e-03
colon cancer -1.400 5.4e-03
Polycystic Ovary Syndrome -1.447 3.7e-03
lung carcinoma -1.900 8.4e-39
Breast cancer -1.400 4.3e-68
invasive ductal carcinoma -1.100 2.3e-03

Synonym

Accession Q04727 F8W6T6 Q3ZCS1 Q5T1Y2 Q6PCB3 Q9BZ07 Q9BZ08 Q9BZ09 Q9NSL3 Q9ULF9
Symbols ESG
BCE1
ESG4
GRG4
BCE-1
Grg-4
E(spI)

Gene

TLE4

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (13)

See all...

 GO Function (3)

 GO Component (2)

 GO Process (4)

 Compartment GO Term (19)

See all...

 MGI Phenotype (7)

 GWAS Trait (1)

 HCA RNA Cell Line (56)

See all...

Pathway (28)

See all...

Protein-protein Interaction (16)

UBB   UBC   CTNNB1   RPS27A   UBA52   TLE3   CDC73   BCL9L   LEO1   TRRAP   TLE1   TLE2   AES   ARMC8   MKLN1   ZMYND19  

Gene RIF (11)

PMID Text
26701208 the results suggested that TLE4, a potential prognostic biomarker for colorectal cancer, plays an important role in the development and progression of human colorectal cancer.
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
24099773 Groucho related gene Grg4 robustly activates the expression of a BMP reporter gene, as well as enhancing and sustaining the upregulation of the endogenous Id1 gene induced by BMP7.
22927467 Displacing coactivators CREB-binding protein/p300 while promoting the recruitment of a corepressor, Grg4.
22169276 Grg4 recruits the arginine methyltransferase PRMT5 to chromatin resulting in symmetric H4R3 dimethylation.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
19893608 germ cell-specific RBMY and hnRNP G-T proteins were more efficient in stimulating TLE4-T incorporation than somatically expressed hnRNP G protein.
19714205 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18258796 Knockdown of TLE1 or TLE4 levels increased the rate of cell division of the AML1-ETO-expressing Kasumi-1 cell line, whereas forced expression of either TLE1 or TLE4 caused apoptosis and cell death.
17060451 Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors

AA Sequence 

MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMY      1 - 70
YEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSH     71 - 140
GHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPS    141 - 210
ASFRGAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLD    211 - 280
KTRLLKKDAPISPASIASSSSTPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKP    281 - 350
PGVDPLASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP    351 - 420
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVV    421 - 490
CAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIW    491 - 560
DLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISND    561 - 630
GTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLH    631 - 700
ESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE    701 - 770
VIY                                                                       771 - 773
//

Text Mined References (38)

PMID Year Title
26701208 2016 TLE4 promotes colorectal cancer progression through activation of JNK/c-Jun signaling pathway.
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24676634 2014 Mutations in PAX2 associate with adult-onset FSGS.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24099773 2013 The Groucho protein Grg4 suppresses Smad7 to activate BMP signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22927467 2012 SUMOylated SoxE factors recruit Grg4 and function as transcriptional repressors in the neural crest.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
22169276 2012 Epigenetic mechanisms of Groucho/Grg/TLE mediated transcriptional repression.
21948523 2011 Post-transcriptional exon shuffling events in humans can be evolutionarily conserved and abundant.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21429299 2011 EphrinB1 interacts with the transcriptional co-repressor Groucho/xTLE4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
19893608 2009 The germ cell nuclear proteins hnRNP G-T and RBMY activate a testis-specific exon.
19714205 2009 Genome-wide association study implicates chromosome 9q21.31 as a susceptibility locus for asthma in mexican children.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18258796 2008 Loss of TLE1 and TLE4 from the del(9q) commonly deleted region in AML cooperates with AML1-ETO to affect myeloid cell proliferation and survival.
18254933 2008 The Groucho/TLE/Grg family of transcriptional co-repressors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17060451 2007 Gbx2 and Otx2 interact with the WD40 domain of Groucho/Tle corepressors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12153506 2002 A new Groucho TLE4 protein may regulate the repressive activity of Pax5 in human B lymphocytes.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8365415 1993 Molecular cloning and expression of mouse and human cDNA encoding AES and ESG proteins with strong similarity to Drosophila enhancer of split groucho protein.
1303260 1992 Human homologs of a Drosophila Enhancer of split gene product define a novel family of nuclear proteins.