Property Summary

NCBI Gene PubMed Count 19
PubMed Score 27.94
PubTator Score 16.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 9.3e-05
glioblastoma 1.300 4.4e-05
group 3 medulloblastoma 1.600 1.7e-03
non-small cell lung cancer 1.092 7.1e-12
lung cancer 2.700 3.7e-04
colon cancer 1.200 4.5e-02
pediatric high grade glioma 1.300 1.9e-04
nasopharyngeal carcinoma 1.200 7.3e-04
ulcerative colitis 1.100 3.7e-04
ovarian cancer 1.600 4.8e-05
Breast cancer 1.600 7.4e-06
pituitary cancer 1.100 2.3e-03

 GO Function (1)

Gene RIF (11)

PMID Text
26004086 TIPIN is important for the maintenance of DNA replication and represents a potential treatment target for the worst prognosis associated breast cancers, such as Triple-negative breast cancer.
23511638 Tim-Tipin complex (or Tim alone) is able to associate with DNA polymerase epsilon bound to a 40-/80-mer DNA ligand.
23359676 Tim-Tipin complex might play a role in coupling DNA unwinding and DNA synthesis by directly affecting the catalytic activities of replication fork proteins.
21490103 We now show that cellular DNA replication fork pausing and protection factors Timeless (Tim) and Tipin (Timeless-interacting protein) accumulate at OriP during S phase of the cell cycle.
20233725 RPA-covered ssDNA not only supports recruitment and activation of ATR but also, through Tipin and Claspin, it plays an important role in the action of ATR on its critical downstream target Chk1
20174623 Observational study of gene-disease association. (HuGE Navigator)
20124417 The results suggest that Timeless-Tipin functions as a replication fork stabilizer that couples DNA replication with sister chromatid cohesion established at replication forks.
17296725 These findings indicate that the Tim-Tipin complex mediates the UV-induced intra-S checkpoint, Tim is needed to maintain DNA replication fork movement, Tipin interacts with RPA on DNA.
17141802 TIM and Tipin are functional orthologs of their replisome-associated yeast counterparts capable of coordinating replication with genotoxic stress responses, and distinguishes mammalian TIM from the circadian-specific paralogs.
17116885 observation explains the similar checkpoint phenotypes observed in both Tipin- and Timeless-depleted cells
17102137 Tipin is a checkpoint mediator that cooperates with Tim and may regulate the nuclear relocation of Claspin in response to replication checkpoint

AA Sequence

MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTVKRNIPKLDAQ      1 - 70
RLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCL     71 - 140
KRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLA    141 - 210
LERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLD    211 - 280
QSFKNVQQQLDATSRNITEAR                                                     281 - 301
//

Text Mined References (27)

PMID Year Title
26004086 2015 TIPIN depletion leads to apoptosis in breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24910198 2014 Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23511638 2013 The human Tim-Tipin complex interacts directly with DNA polymerase epsilon and stimulates its synthetic activity.
23359676 2013 Human Tim-Tipin complex affects the biochemical properties of the replicative DNA helicase and DNA polymerases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21490103 2011 The replisome pausing factor Timeless is required for episomal maintenance of latent Epstein-Barr virus.
20233725 2010 Tipin-replication protein A interaction mediates Chk1 phosphorylation by ATR in response to genotoxic stress.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
20139726 2010 The many facets of the Tim-Tipin protein families' roles in chromosome biology.
20124417 2010 Human Timeless and Tipin stabilize replication forks and facilitate sister-chromatid cohesion.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17296725 2007 The human Tim/Tipin complex coordinates an Intra-S checkpoint response to UV that slows replication fork displacement.
17141802 2007 Mammalian TIMELESS and Tipin are evolutionarily conserved replication fork-associated factors.
17116885 2006 Tipin and Timeless form a mutually protective complex required for genotoxic stress resistance and checkpoint function.
17102137 2007 Human Tim/Timeless-interacting protein, Tipin, is required for efficient progression of S phase and DNA replication checkpoint.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12875843 2003 Tipin, a novel timeless-interacting protein, is developmentally co-expressed with timeless and disrupts its self-association.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.