Property Summary

NCBI Gene PubMed Count 58
PubMed Score 109.22
PubTator Score 89.67

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKM      1 - 70
LRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDL     71 - 140
SLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRG    141 - 210
HLPLRKEFVDIVQP                                                            211 - 224
//