Property Summary

NCBI Gene PubMed Count 15
PubMed Score 30.46
PubTator Score 25.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.505 6.8e-03
astrocytic glioma -1.300 4.2e-02
ependymoma -1.200 2.3e-02
psoriasis 1.600 8.7e-05
atypical teratoid / rhabdoid tumor -1.300 1.2e-05
medulloblastoma -1.100 1.5e-04
medulloblastoma, large-cell -1.100 1.3e-03
hereditary spastic paraplegia -1.036 1.4e-02
pancreatic ductal adenocarcinoma liver m... -1.142 3.7e-02
intraductal papillary-mucinous neoplasm ... 1.400 7.3e-03
lung cancer 1.800 2.7e-04
breast carcinoma 1.200 1.0e-21
ductal carcinoma in situ 1.100 5.1e-03
invasive ductal carcinoma 1.300 1.0e-04
ovarian cancer 1.400 3.3e-02
Breast cancer 1.300 1.5e-06

Gene RIF (5)

PMID Text
26977020 TIMM17A has a profound impact on the cellular function of breast cancer cells. A decrease of TIMM17A expression is associated with the reduction of the aggressiveness of breast cancer cells.
20972741 High TIMM17A expression is associated with adverse pathological outcomes in breast cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20198662 mRNA expression analysis and immunohistochemistry analysis in breast cancer tissues indicated that expression level of TIMM17A was directly correlated with tumor progression; survival analysis suggested TIMM17A was a prognosis factor in breast cancer.
18826960 Tim17 is a conserved suppressor of mtDNA instability.

AA Sequence

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWG      1 - 70
GLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQ     71 - 140
FPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ                                           141 - 171
//

Text Mined References (17)

PMID Year Title
26977020 2016 The Impact of TIMM17A on Aggressiveness of Human Breast Cancer Cells.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20972741 2012 High TIMM17A expression is associated with adverse pathological and clinical outcomes in human breast cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20198662 2010 Quantitative proteomics study of breast cancer cell lines isolated from a single patient: discovery of TIMM17A as a marker for breast cancer.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
18826960 2009 The conserved translocase Tim17 prevents mitochondrial DNA loss.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119107 2002 Human aminopeptidase B (rnpep) on chromosome 1q32.2: complementary DNA, genomic structure and expression.
10393182 1999 The TIM17.23 preprotein translocase of mitochondria: composition and function in protein transport into the matrix.
10339406 1999 Genetic and structural characterization of the human mitochondrial inner membrane translocase.
8893850 1996 The preprotein translocase of the inner mitochondrial membrane: evolutionary conservation of targeting and assembly of Tim17.