Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25

Knowledge Summary


No data available


AA Sequence

YLEQQDDMLLSDKLVLRRLRTIIRKKQKIQNNKNH                                       491 - 525

Text Mined References (6)

PMID Year Title