Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.58
PubTator Score 6.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.089 4.8e-03
Multiple myeloma 1.134 1.9e-03
osteosarcoma -1.335 2.9e-04
cystic fibrosis 1.089 4.8e-05
tuberculosis and treatment for 6 months -1.300 6.3e-03
lung cancer 1.900 1.8e-04
ovarian cancer 1.900 1.3e-04

Synonym

Accession Q9P016 Q567Q2 Q9H3L4 Q9HC20
Symbols MY105
THY28
MDS012
HSPC144
THY28KD

Gene

PDB

3EOP   5J3E  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
19237743 The 2.3A-resolution structure revealed only one 2-fold axis of rotational pseudosymmetry. A potential RNA-binding domain from human YTH-domain-containing protein 2 has the most similar 3-D fold to that of the DUF55 domain; it may be an RNA-related domain.
15939300 HSPC144 was expressed and purified, and a stable fragment (residues 44-225) was identified by limited proteolysis method.
12384300 Studies of the mouse counterpart.

AA Sequence

MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKG      1 - 70
VDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQF     71 - 140
EKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQ    141 - 210
EEFDFVLSLEEKEPS                                                           211 - 225
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19237743 2009 Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15939300 2005 Identification, expression, and purification of a unique stable domain from human HSPC144 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14601557 2003 Anti-IgM-induced down-regulation of nuclear Thy28 protein expression in Ramos B lymphoma cells.
14580360 2003 Modulation of mThy28 nuclear protein expression during thymocyte development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384300 2002 Molecular cloning and characterization of the mouse thymocyte protein gene.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.