Property Summary

NCBI Gene PubMed Count 31
PubMed Score 139.24
PubTator Score 37.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 7.4e-03

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.158 7.4e-03

Gene RIF (13)

PMID Text
25180910 THOP1 may have clinical potentials to be employed as a promising biomarker to identify individuals with better prognosis and a novel antitumor agent for therapy of patients with NSCLC
24604581 Low THOP1 expression levels are associated with recurrence of hepatocellular carcinoma.
24223886 TCEP. Data indicate that THIMET-oligopeptidase (TOP) oxidation by H2O2 and high valence states of hemeproteins does not lead to enzyme oligomerization.
23708739 shear-dependent TOP induction down-regulates MHC1 levels, pointing to a role for TOP in the flow-mediated regulation of endothelial immunogenicity
22796113 The semi-quantitative intracellular peptidome analyses of siRNA-transfected HEK293 cells shows that the levels of specific intracellular peptides are either increased or decreased upon EP24.15 inhibition.
21151101 mediates antigen processing that generates cytotoxic T cell epitopes
19614740 interaction between EP24.15 and calmodulin is regulated within cells and is important for the stimulated secretion of EP24.15 from HEK293 cells.
19282285 Over 100 peptides were identified in human embryonic kidney 293 (HEK293) cells that are derived from intracellular proteins; many but not all of these peptides are substrates or products of EP24.15.
18571100 increase in THOP1 expression might be part of a compensatory defense mechanism of the brain against an increased Abeta load.
17251185 Mutations at only two residues (Glu-469 and Arg-498) are required to swap specificity with neurolysin, a result that is confirmed by testing the two-mutant constructs.
15376229 EP24.15 associates with AT1 and B2 receptors both at the plasma membrane and after receptor internalization
15328361 THIMET has a role in degradation of peptides generated by proteasomes
14998993 human thimet oligopeptidase crystal structure shows substrate recognition, regulation, and localization

AA Sequence

MKPPAACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKALAD      1 - 70
VEVTYTVQRNILDFPQHVSPSKDIRTASTEADKKLSEFDVEMSMREDVYQRIVWLQEKVQKDSLRPEAAR     71 - 140
YLERLIKLGRRNGLHLPRETQENIKRIKKKLSLLCIDFNKNLNEDTTFLPFTLQELGGLPEDFLNSLEKM    141 - 210
EDGKLKVTLKYPHYFPLLKKCHVPETRRKVEEAFNCRCKEENCAILKELVTLRAQKSRLLGFHTHADYVL    211 - 280
EMNMAKTSQTVATFLDELAQKLKPLGEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQVEETRYC    281 - 350
VDQNLLKEYFPVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREG    351 - 420
KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADAPSLLQHDEVETYFHEFGHVMHQLCSQAEFAM    421 - 490
FSGTHVERDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAVPRELLEKLIESRQANTGLFNLRQIVLAKV    491 - 560
DQALHTQTDADPAEEYARLCQEILGVPATPGTNMPATFGHLAGGYDAQYYGYLWSEVYSMDMFHTRFKQE    561 - 630
GVLNSKVGMDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQVC               631 - 689
//

Text Mined References (36)

PMID Year Title
25180910 2014 Expression of THOP1 and its relationship to prognosis in non-small cell lung cancer.
24604581 2014 Expression analysis of THOP1 in background liver, a prognostic predictive factor in hepatocellular carcinoma, extracted by multiarray analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223886 2013 Recycling of the high valence States of heme proteins by cysteine residues of THIMET-oligopeptidase.
23708739 2013 Shear stress is a positive regulator of thimet oligopeptidase (EC3.4.24.15) in vascular endothelial cells: consequences for MHC1 levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22796113 2012 Inhibition of thimet oligopeptidase by siRNA alters specific intracellular peptides and potentiates isoproterenol signal transduction.
21269460 2011 Initial characterization of the human central proteome.
21151101 2011 Antigen processing by nardilysin and thimet oligopeptidase generates cytotoxic T cell epitopes.
19614740 2009 Interaction with calmodulin is important for the secretion of thimet oligopeptidase following stimulation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19282285 2009 Analysis of intracellular substrates and products of thimet oligopeptidase in human embryonic kidney 293 cells.
18571100 2008 Increased expression of the oligopeptidase THOP1 is a neuroprotective response to Abeta toxicity.
17251185 2007 Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15376229 EP24.15 interacts with the angiotensin II type I receptor and bradykinin B2 receptor.
15328361 2004 Pathway for degradation of peptides generated by proteasomes: a key role for thimet oligopeptidase and other metallopeptidases.
15231747 2004 A protein interaction framework for human mRNA degradation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14998993 2004 Crystal structure of human thimet oligopeptidase provides insight into substrate recognition, regulation, and localization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12648459 2003 The cytosolic endopeptidase, thimet oligopeptidase, destroys antigenic peptides and limits the extent of MHC class I antigen presentation.
12502762 2003 Localization of EP24.15, a major liver kininase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11479311 2001 Major histocompatibility complex class I-presented antigenic peptides are degraded in cytosolic extracts primarily by thimet oligopeptidase.
10993116 2000 Thimet oligopeptidase EC 3.4.24.15 is a major liver kininase.
10969067 2000 The neuropeptide processing enzyme EC 3.4.24.15 is modulated by protein kinase A phosphorylation.
10541437 1999 Secretion of metalloendopeptidase 24.15 (EC 3.4.24.15).
10504294 1999 Distribution of thimet oligopeptidase (E.C. 3.4.24.15) in human and rat testes.
10415366 1999 The association of metalloendopeptidase EC 3.4.24.15 at the extracellular surface of the AtT-20 cell plasma membrane.
9790774 1998 Human endopeptidase 24.15 (THOP1) is localized on chromosome 19p13.3 and is excluded from the linkage region for late-onset Alzheimer disease.
8824811 1996 Human endopeptidase (THOP1) is localized on chromosome 19 within the linkage region for the late-onset alzheimer disease AD2 locus.
8373360 1993 Human thimet oligopeptidase.
8286339 1994 Identification of a metalloprotease from Alzheimer's disease brain able to degrade the beta-amyloid precursor protein and generate amyloidogenic fragments.
7639763 1995 Cloning and functional expression of a metalloendopeptidase from human brain with the ability to cleave a beta-APP substrate peptide.