| Tbio | Thimet oligopeptidase |
Involved in the metabolism of neuropeptides under 20 amino acid residues long. Involved in cytoplasmic peptide degradation. Able to degrade the beta-amyloid precursor protein and generate amyloidogenic fragments.
The protein encoded by this gene is a kininase that uses zinc as a cofactor. The encoded oligopeptidase cleaves cytosolic peptides, making them unavailable for display on antigen-presenting cells. This protein also cleaves neuropeptides under 20 aa in length and can degrade beta-amyloid precursor protein to amyloidogenic peptides. [provided by RefSeq, Nov 2015]
The protein encoded by this gene is a kininase that uses zinc as a cofactor. The encoded oligopeptidase cleaves cytosolic peptides, making them unavailable for display on antigen-presenting cells. This protein also cleaves neuropeptides under 20 aa in length and can degrade beta-amyloid precursor protein to amyloidogenic peptides. [provided by RefSeq, Nov 2015]
Comments
| PMID | Text | |
|---|---|---|
| 25180910 | THOP1 may have clinical potentials to be employed as a promising biomarker to identify individuals with better prognosis and a novel antitumor agent for therapy of patients with NSCLC | |
| 24604581 | Low THOP1 expression levels are associated with recurrence of hepatocellular carcinoma. | |
| 24223886 | TCEP. Data indicate that THIMET-oligopeptidase (TOP) oxidation by H2O2 and high valence states of hemeproteins does not lead to enzyme oligomerization. | |
| 23708739 | shear-dependent TOP induction down-regulates MHC1 levels, pointing to a role for TOP in the flow-mediated regulation of endothelial immunogenicity | |
| 22796113 | The semi-quantitative intracellular peptidome analyses of siRNA-transfected HEK293 cells shows that the levels of specific intracellular peptides are either increased or decreased upon EP24.15 inhibition. | |
| 21151101 | mediates antigen processing that generates cytotoxic T cell epitopes | |
| 19614740 | interaction between EP24.15 and calmodulin is regulated within cells and is important for the stimulated secretion of EP24.15 from HEK293 cells. | |
| 19282285 | Over 100 peptides were identified in human embryonic kidney 293 (HEK293) cells that are derived from intracellular proteins; many but not all of these peptides are substrates or products of EP24.15. | |
| 18571100 | increase in THOP1 expression might be part of a compensatory defense mechanism of the brain against an increased Abeta load. | |
| 17251185 | Mutations at only two residues (Glu-469 and Arg-498) are required to swap specificity with neurolysin, a result that is confirmed by testing the two-mutant constructs. | |
| 15376229 | EP24.15 associates with AT1 and B2 receptors both at the plasma membrane and after receptor internalization | |
| 15328361 | THIMET has a role in degradation of peptides generated by proteasomes | |
| 14998993 | human thimet oligopeptidase crystal structure shows substrate recognition, regulation, and localization |
MKPPAACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKALAD 1 - 70 VEVTYTVQRNILDFPQHVSPSKDIRTASTEADKKLSEFDVEMSMREDVYQRIVWLQEKVQKDSLRPEAAR 71 - 140 YLERLIKLGRRNGLHLPRETQENIKRIKKKLSLLCIDFNKNLNEDTTFLPFTLQELGGLPEDFLNSLEKM 141 - 210 EDGKLKVTLKYPHYFPLLKKCHVPETRRKVEEAFNCRCKEENCAILKELVTLRAQKSRLLGFHTHADYVL 211 - 280 EMNMAKTSQTVATFLDELAQKLKPLGEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQVEETRYC 281 - 350 VDQNLLKEYFPVQVVTHGLLGIYQELLGLAFHHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREG 351 - 420 KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADAPSLLQHDEVETYFHEFGHVMHQLCSQAEFAM 421 - 490 FSGTHVERDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAVPRELLEKLIESRQANTGLFNLRQIVLAKV 491 - 560 DQALHTQTDADPAEEYARLCQEILGVPATPGTNMPATFGHLAGGYDAQYYGYLWSEVYSMDMFHTRFKQE 561 - 630 GVLNSKVGMDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQVC 631 - 689 //
| PMID | Year | Title | |
|---|---|---|---|
| 25180910 | 2014 | Expression of THOP1 and its relationship to prognosis in non-small cell lung cancer. | |
| 24604581 | 2014 | Expression analysis of THOP1 in background liver, a prognostic predictive factor in hepatocellular carcinoma, extracted by multiarray analysis. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 24223886 | 2013 | Recycling of the high valence States of heme proteins by cysteine residues of THIMET-oligopeptidase. | |
| 23708739 | 2013 | Shear stress is a positive regulator of thimet oligopeptidase (EC3.4.24.15) in vascular endothelial cells: consequences for MHC1 levels. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. | |
| 22796113 | 2012 | Inhibition of thimet oligopeptidase by siRNA alters specific intracellular peptides and potentiates isoproterenol signal transduction. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21151101 | 2011 | Antigen processing by nardilysin and thimet oligopeptidase generates cytotoxic T cell epitopes. | |
| 19614740 | 2009 | Interaction with calmodulin is important for the secretion of thimet oligopeptidase following stimulation. | |
| 19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. | |
| 19282285 | 2009 | Analysis of intracellular substrates and products of thimet oligopeptidase in human embryonic kidney 293 cells. | |
| 18571100 | 2008 | Increased expression of the oligopeptidase THOP1 is a neuroprotective response to Abeta toxicity. | |
| 17251185 | 2007 | Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15376229 | EP24.15 interacts with the angiotensin II type I receptor and bradykinin B2 receptor. | ||
| 15328361 | 2004 | Pathway for degradation of peptides generated by proteasomes: a key role for thimet oligopeptidase and other metallopeptidases. | |
| 15231747 | 2004 | A protein interaction framework for human mRNA degradation. | |
| 15057824 | 2004 | The DNA sequence and biology of human chromosome 19. | |
| 14998993 | 2004 | Crystal structure of human thimet oligopeptidase provides insight into substrate recognition, regulation, and localization. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12648459 | 2003 | The cytosolic endopeptidase, thimet oligopeptidase, destroys antigenic peptides and limits the extent of MHC class I antigen presentation. | |
| 12502762 | 2003 | Localization of EP24.15, a major liver kininase. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11479311 | 2001 | Major histocompatibility complex class I-presented antigenic peptides are degraded in cytosolic extracts primarily by thimet oligopeptidase. | |
| 10993116 | 2000 | Thimet oligopeptidase EC 3.4.24.15 is a major liver kininase. | |
| 10969067 | 2000 | The neuropeptide processing enzyme EC 3.4.24.15 is modulated by protein kinase A phosphorylation. | |
| 10541437 | 1999 | Secretion of metalloendopeptidase 24.15 (EC 3.4.24.15). | |
| 10504294 | 1999 | Distribution of thimet oligopeptidase (E.C. 3.4.24.15) in human and rat testes. | |
| 10415366 | 1999 | The association of metalloendopeptidase EC 3.4.24.15 at the extracellular surface of the AtT-20 cell plasma membrane. | |
| 9790774 | 1998 | Human endopeptidase 24.15 (THOP1) is localized on chromosome 19p13.3 and is excluded from the linkage region for late-onset Alzheimer disease. | |
| 8824811 | 1996 | Human endopeptidase (THOP1) is localized on chromosome 19 within the linkage region for the late-onset alzheimer disease AD2 locus. | |
| 8373360 | 1993 | Human thimet oligopeptidase. | |
| 8286339 | 1994 | Identification of a metalloprotease from Alzheimer's disease brain able to degrade the beta-amyloid precursor protein and generate amyloidogenic fragments. | |
| 7639763 | 1995 | Cloning and functional expression of a metalloendopeptidase from human brain with the ability to cleave a beta-APP substrate peptide. |
