Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.95
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (1)

AA Sequence

MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQ      1 - 70
KNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARHSEAAPGPVSCTRPRAGKQAA     71 - 140
ASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATT    141 - 210
QTEELWSRTSSLFDIYSSDSETDTDWDIKSEQSDLSYMAVQVKEETC                           211 - 257
//

Text Mined References (9)

PMID Year Title