Property Summary

NCBI Gene PubMed Count 123
PubMed Score 73.11
PubTator Score 121.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2346 3.19 1.6
Premature ovarian failure 64 3.081 1.5
Cysticercosis 12 3.04 1.5

Expression

 CSPA Cell Line (3)

Gene RIF (98)

PMID Text
26548418 No correlation of loss of heterozygosity at the TGFBR3 locus with clinicopathological parameters suggests that allelic imbalance may be an early genetic event during neoplastic transformation of human endometrium.
26531330 Study shows that TbetaRIII expression is significantly decreased in salivary glands adenoid cystic carcinoma (ACC) patients and defines TbetaRIII as a biomarker exerting antitumor action on ACC progression.
26383992 The presence of the index SNP rs1192415 (TGFBR3-CDC7) was associated with visual field progression in POAG (primary open-angle glaucoma) patients.
26205654 results suggest overexpression of TbetaRIII receptor restored TGF-beta1 sensitivity in CAL-27 cells
26190421 Data suggest a high potential of plasma sTBFbetarIII as a novel diagnostic and prognostic biomarker in breast cancer.
25861811 rs1192415 of TGFBR3 is associated with primary open angle glaucoma.
25728278 Data indicate that TGF-beta2 (TGFB2) and TGF beta type III receptor (TGFBR3) are target genes of miR-193b in chondrogenesis.
25728212 Study shows that GDF10 is down-regulated in patients with oral squamous cell carcinoma, and is an independent risk factor for overall survival. Its expression is regulated by TGFBR3 which shares the signaling inhibiting epithelial-mesenchymal transition.
25677673 RS1805110 is not associated with Behcet's disease or idiopathic intermediate uveitis in Caucasian patients.
25390077 data suggest complex or phenotype specific association of cryptorchidism with TGFBR3 and the gubernaculum as a potential target of TGFbeta signaling
25128652 NFkappaB/TGFbeta2 promotes, and betaglycan impedes, the early stages of granulosa cell tumor metastasis, when tumor cells first invade the peritoneum
25077702 These data demonstrate that TbetaRIII regulates BMP-mediated signaling and biological effects, primarily through the ligand sequestration effects of sTbetaRIII in normal and cancerous mammary epithelial cells.
24985072 We have found that TbetaRIII is required for migration and invasion in vitro and xenograft growth in vivo.
24966170 Inhibiting ectodomain shedding of TbetaRIII increased TGF-beta responsiveness and abrogated TbetaRIII's ability to inhibit breast cancer cell migration and invasion.
24870032 Proper localization of TGFBRIII is critical for maintenance of epithelial cell polarity and phenotype.
24705316 Report the presence of TGFBR3 and/or MGEA5 rearrangements in pleomorphic hyalinizing angiectatic tumors and the spectrum of related neoplasms.
24658685 Cells in contact with basement membrane undergo transient oscillations between two molecular states defined by their TGFBR3- JUND expression.
24551192 Antibodies against TGF-beta or a TGF-beta receptor inhibitor SB431452 reverse HIV-1 Vpu-mediated profibrogenic activation of LX2 cells, suggesting that TGF-beta mediates these effects
24347165 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-beta signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24216509 TbetaRIII bound FGF2 and exogenous FGFR1, which promoted neuronal differentiation of neuroblastoma cells. TbetaRIII and FGF2 cooperated to induce expression of the transcription factor inhibitor of DNA binding 1 via Erk MAPK.
24124001 TGFBR3 co-downregulated with GATA3 is associated with methylation of the GATA3 gene in bladder urothelial carcinoma.
23835618 Low TGFBR3 expression is associated with bladder urothelial carcinoma and enhanced in the invasive bladder cancer.
23387308 Therefore transient overexpression of TGFBR3 may be a novel strategy for nasopharyngeal carcinoma prevention and therapy
23322721 TGFbeta2 increased NFkappaB reporter activity in control cells, but betaglycan expression suppressed both basal and TGFbeta2-stimulated NFkappaB activity.
23226100 These results reveal a novel function of the matricellular protein CCN6 and establish a mechanistic link between CCN6 and TbetaRIII in maintaining acinar organization in the breast.
23092981 Polymorphisms in the betaglycan gene, a co-receptor mediating functional antagonism of activin signalling, significantly predict antidepressant drug treatment outcome in a system-wide pharmacogenetics study in depression.
22927969 a differential regulation of Smads and TGF-beta receptors
22562249 Clinically relevant role for TbetaRIII in regulating integrin alpha5 localization, reveal a novel crosstalk mechanism between the integrin and TGF-beta superfamily signaling pathways.
22479366 Data show that granzyme B (GrB) liberated TGF-beta1 from substrates decorin, biglycan and betaglycan.
22440163 rs1805110 CC genotype in TGFBR3 is probably associated with the protection from BD. The tested two TGFBR3 SNPs are not associated with VKH disease.
22300218 Variations in TGFBR3 gene appear not to be associated with Marfan syndrome or related phenotype.
22290546 the rs1805110T allele is associated with susceptibility to HBV-related hepatocellular carcinoma in males
22140272 Markers located in the region of TGFBR3 and BMP7 showed association with all testicular dysgenesis syndrome phenotypes in both the discovery and replication cohorts
22036907 Novel missense mutations in the TGFBR3 gene are associated with premature ovarian failure in Chinese women.
21847367 These data support a model whereby TbetaRIII mediates TGF-beta superfamily ligand-induced colon cancer progression and support a context-dependent role for TbetaRIII in regulating cancer progression.
21829018 TGFBR3 polymorphisms and its haplotypes might be associated with hepatitis B virus clearance and age of hepatocellular carcinoma occurrence.
21756058 TGFBR3 mutations may be responsible for the genetic aetiology of idiopathic premature ovarian failure in Chinese patients.
21717526 Chromosomal translocation t(1;10) is consistent with rearrangements of TGFBR3 and MGEA5 in both myxoinflammatory fibroblastic sarcoma and hemosiderotic fibrolipomatous tumor.
21411633 type III transforming growth factor-beta protein expression is decreased in human multiple myeloma specimens.
21307088 Polymorphisms of ATOH7, TGFBR3 and CARD10 influence the size of optic disc area.
21297076 TGFBR3 is associated with acute lung injury in mice
21261473 endometrial cancer is associated with disruption of accessory receptor betaglycan expression, what may alter TGFbeta2-induced signaling.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20677641 Reduced expression of TGFBR3 was observed in non-small cell lung cancer(NSCLC) cell lines, especially in 95D, suggesting that TGFBR3 might play an important role in development and progression of NSCLC.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20406198 Use of sucrose-density ultracentrifugation to isolate membrane-raft fractions demonstrates recruitment of both TGFBbeta receptor (TGFbetaR)II and TGFbetaRI to non-raft membrane fractions by TGFbetaRIII.
20386084 Association of genetic variants in TGFBR3 and asthma in a Korean population.
20386084 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20208565 Loss of type III transforming growth factor-beta receptor expression is due to methylation silencing of the transcription factor GATA3 in renal cell carcinoma.
20178540 report demonstrates the aberrantly increased expression of betaglycan mRNA in polycystic ovary syndrome ovaries; mechanism by which betaglycan contributes to the pathologic process of PCOS remains to be clarified
20153821 A review on the role of TbetaRIII as a suppressor of cancer progression and/or as a metastasis suppressor.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19842711 Partial plasmin digestion of soluble betaglycan produces two proteolysis-resistant fragments of 45 and 55 kilodaltons (kDa) corresponding, respectively, to betaglucan membrane-distal and -proximal regions.
19639191 results of this study suggest that TGFbetaRIII is transcriptionally down-regulated in hepatocellular carcinoma; in addition, genetic alterations did not appear to be associated with the reduced expression level of TGFbetaRIII
19453261 Observational study of gene-disease association. (HuGE Navigator)
19416857 an unexpected TGF-beta signaling independent role for TbetaRIII in activating Cdc42, altering the actin cytoskeleton and reducing directional persistence to inhibit random migration of both cancer and normal epithelial cells
19299629 Observational study of gene-disease association. (HuGE Navigator)
19249006 ADAMTS18 and TGFBR3 might underlie BMD determination in the major human ethnic groups.
19249006 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19164448 These data suggest that loss of betaglycan contributes to the pathogenesis of ovarian granulosa cell tumors.
19131638 Stratified linkage analysis followed by association testing identified TGFBR3 (betaglycan) as a potential susceptibility gene for COPD.
19131638 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18931647 Report overexpression of TGFBR3 in pancreatic islets of nesidioblastosis patients.
18845534 clathrin-independent endocytosis of T beta RIII has a role in regulating both Smad-dependent and Smad-independent TGF-beta signaling
18398939 Mesenchymal stem cells from patients with osteoarthritis showed significantly increased total TGF-beta, TGF-beta1 isoform, TBR-II, and TBR-III mRNA expression compared to controls.
18397882 a high affinity interaction between betaglycan and residues Val(108)-Tyr(120) of the inhibin alpha-subunit mediate inhibin A biological activity
18315732 Observational study of gene-disease association. (HuGE Navigator)
18299279 TGF-beta1-mediates downregulation of TbetaRIII mRNA expression through effects on the ALK5/Smad2/3 pathway.
18184661 The ability of TbetaRIII to serve as a cell surface receptor and mediate BMP, inhibin, and TGF-beta signaling suggests a broader role for TbetaRIII in orchestrating TGF-beta superfamily signaling.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18097622 The aim of this study was to analyse the profile of TGF-beta1 and the expression of its receptor (TbetaR I, TbetaR II and TbetaR III-betaglycan) genes in IPAH and in secondary forms of pulmonary arterial hypertension [Eisenmenger's syndrome patients].
17999987 type III transforming growth factor beta receptor has a role in preventing motility and invasiveness associated with epithelial to mesenchymal transition during pancreatic cancer progression
17602227 in bone fracture patients, 12 proteins were related to bone/cartilage metabolism, including: TGF-beta induced protein IG-H(3), cartilage acidic protein 1, procollagen C proteinase enhancer protein and TGF-beta receptor III.
17408468 Observational study of gene-disease association. (HuGE Navigator)
17272393 glycosylation of Asn(302) of the alpha-subunit of inhibin A and B results in a decrease in bioactivity, and the effect on inhibin A, at least, is explained by its reduced affinity to betaglycan
17192875 TGFBR3 is the TGF-beta component most commonly downregulated among localized human prostate cancer studies. TGFBR3 knockdown led to focus formation and enhanced expression of CD133, a marker found on prostate cancer stem cells.
17084394 Mutational analysis of betaglycan/TGF-betaRIII in premature ovarian failure.
16886151 Observational study of gene-disease association. (HuGE Navigator)
16621788 analysis of inhibin and transforming growth factor beta-binding sites on betaglycan
16613887 Observational study of gene-disease association. (HuGE Navigator)
16613887 This study establishes the first mutational report of the TGFBR3 gene in correlation with ovarian failure. Significant diversity of genotype distribution and haplotype analysis suggested susceptibility of the TGFBR3 gene for ovarian failure aetiology.
15745937 The lower inhibin alpha and betaglycan expression in endometrial adenocarcinoma suggests that the inhibin action may be disrupted.
15009106 Observational study of gene-disease association. (HuGE Navigator)
14704634 expression values for TGF 1 and its receptors I, II, and III were twice as high in the group of patients with a diagnosis of high-grade lymphomas as in the group of patients diagnosed with low-grade lymphomas
14585090 Betaglycan mRNA and peptide are expressed by the trophoblast, the decidua and the fetal membranes, but the localization of the peptide in vessel walls is dependent on gestational age.
14557487 The specific expression and regulation pattern of betaglycan gene may be related to the functional antagonism of inhibins to activin signal transduction in human ovaries
12970754 We observed loss of type III TGFbeta receptor (TBR3) expression in all renal cell carcinoma samples
12958365 findings indicate a physiologically significant, unanticipated role for beta arrestin 2 in regulating TGF-beta signaling through internalization and subsequent decreased signaling of TGF-beta receptors
12873459 Observational study of gene-disease association. (HuGE Navigator)
12782414 analysis of expression and cellular compartmentalization of the activin receptors ActRIIA, ActRIIB and ActRIB, the inhibin co-receptor (betaglycan), and activin signaling proteins Smads 2, 3 and 4, and growth regulatory role during lactation
12651901 Results quantify the relative expression of inhibin alpha, inhibin/activin beta(A), beta(B), beta(C), follistatin, activin receptors and beta-glycan genes in placental tissue of term pre-eclamptic patients.
12568406 endoglin and betaglycan have a critical role in the regulation of TGFbeta signaling in chondrocytes
12358857 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLR      1 - 70
TAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSA     71 - 140
NFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLA    141 - 210
EYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVN    211 - 280
WVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANR    281 - 350
FHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDG    351 - 420
LPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAK    421 - 490
MNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDAS    491 - 560
LFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQ    561 - 630
ELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSL    631 - 700
LFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKE    701 - 770
PNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGST    771 - 840
QSTPCSSSSTA                                                               841 - 851
//

Text Mined References (125)

PMID Year Title
26548418 2016 Significance of TGFBR3 allelic loss in the deregulation of TGF? signaling in primary human endometrial carcinomas.
26531330 2016 Type III TGF-? receptor inhibits cell proliferation and migration in salivary glands adenoid cystic carcinoma by suppressing NF-?B signaling.
26383992 2015 A Genetic Variant in TGFBR3-CDC7 Is Associated with Visual Field Progression in Primary Open-Angle Glaucoma Patients from Singapore.
26205654 2015 Overexpression of transforming growth factor type III receptor restores TGF-?1 sensitivity in human tongue squamous cell carcinoma cells.
26190421 2015 Soluble type III TGF? receptor in diagnosis and follow-up of patients with breast cancer.
25861811 2015 A common variant near TGFBR3 is associated with primary open angle glaucoma.
25728278 2015 MiR-193b regulates early chondrogenesis by inhibiting the TGF-beta2 signaling pathway.
25728212 2016 Loss of GDF10/BMP3b as a prognostic marker collaborates with TGFBR3 to enhance chemotherapy resistance and epithelial-mesenchymal transition in oral squamous cell carcinoma.
25677673 2015 Association analysis of TGFBR3 gene with Behçet's disease and idiopathic intermediate uveitis in a Caucasian population.
25390077 2015 Phenotype specific association of the TGFBR3 locus with nonsyndromic cryptorchidism.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25128652 2014 Betaglycan blocks metastatic behaviors in human granulosa cell tumors by suppressing NF?B-mediated induction of MMP2.
25077702 2014 The balance of cell surface and soluble type III TGF-? receptor regulates BMP signaling in normal and cancerous mammary epithelial cells.
24985072 2014 Transforming growth factor beta receptor type III is a tumor promoter in mesenchymal-stem like triple negative breast cancer.
24966170 2014 Ectodomain shedding of T?RIII is required for T?RIII-mediated suppression of TGF-? signaling and breast cancer migration and invasion.
24870032 2014 Role of TGF-? receptor III localization in polarity and breast cancer progression.
24705316 2014 TGFBR3 and MGEA5 rearrangements in pleomorphic hyalinizing angiectatic tumors and the spectrum of related neoplasms.
24658685 2014 A time- and matrix-dependent TGFBR3-JUND-KRT5 regulatory circuit in single breast epithelial cells and basal-like premalignancies.
24347165 2014 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-? signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24216509 2013 Type III TGF-? receptor promotes FGF2-mediated neuronal differentiation in neuroblastoma.
24124001 2013 TGFBR3 co-downregulated with GATA3 is associated with methylation of the GATA3 gene in bladder urothelial carcinoma.
23835618 2013 Dual role of TGFBR3 in bladder cancer.
23387308 2013 Transient overexpression of TGFBR3 induces apoptosis in human nasopharyngeal carcinoma CNE-2Z cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23322721 2013 Betaglycan alters NF?B-TGF?2 cross talk to reduce survival of human granulosa tumor cells.
23226100 2012 CCN6 knockdown disrupts acinar organization of breast cells in three-dimensional cultures through up-regulation of type III TGF-? receptor.
23209189 2013 Genome-wide association study for type 2 diabetes in Indians identifies a new susceptibility locus at 2q21.
23092981 2012 Convergent animal and human evidence suggests the activin/inhibin pathway to be involved in antidepressant response.
22927969 2012 Differential regulation of Smad3 and of the type II transforming growth factor-? receptor in mitosis: implications for signaling.
22562249 2013 T?RIII/?-arrestin2 regulates integrin ?5?1 trafficking, function, and localization in epithelial cells.
22479366 2012 Granzyme B cleaves decorin, biglycan and soluble betaglycan, releasing active transforming growth factor-?1.
22440163 2012 Association analysis of TGFBR3 gene with Vogt-Koyanagi-Harada disease and Behcet's disease in the Chinese Han population.
22300218 2012 TGFBR3 variation is not a common cause of Marfan-like syndrome and Loeys-Dietz-like syndrome.
22290546 2012 Polymorphisms in the potential functional regions of the TGF-? 1 and TGF-? receptor genes and disease susceptibility in HBV-related hepatocellular carcinoma patients.
22140272 2012 A genome-wide association study of men with symptoms of testicular dysgenesis syndrome and its network biology interpretation.
22036907 2011 Identification of novel missense mutations of the TGFBR3 gene in Chinese women with premature ovarian failure.
21847367 2011 Type III TGF-? receptor enhances colon cancer cell migration and anchorage-independent growth.
21829018 2011 TGFBR3 polymorphisms and its haplotypes associated with chronic hepatitis B virus infection and age of hepatocellular carcinoma occurrence.
21756058 2012 Haplotype and mutation analysis of the TGFBR3 gene in Chinese women with idiopathic premature ovarian failure.
21717526 2011 Consistent t(1;10) with rearrangements of TGFBR3 and MGEA5 in both myxoinflammatory fibroblastic sarcoma and hemosiderotic fibrolipomatous tumor.
21411633 2011 The type III transforming growth factor-? receptor inhibits proliferation, migration, and adhesion in human myeloma cells.
21307088 2011 Genome-wide association studies in Asians confirm the involvement of ATOH7 and TGFBR3, and further identify CARD10 as a novel locus influencing optic disc area.
21297076 2011 Haplotype association mapping of acute lung injury in mice implicates activin a receptor, type 1.
21261473 2011 Dysregulation of betaglycan expression in primary human endometrial carcinomas.
20856203 2011 Critical role of endoglin in tumor cell plasticity of Ewing sarcoma and melanoma.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20677641 2010 [Defective expression of TGFBR3 gene and its molecular mechanisms in non-small cell lung cancer cell lines].
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20548946 2010 A genome-wide association study of optic disc parameters.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20406198 2010 TGF beta (transforming growth factor beta) receptor type III directs clathrin-mediated endocytosis of TGF beta receptor types I and II.
20386084 2010 Association between genetic variations of the transforming growth factor ß receptor type III and asthma in a Korean population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20208565 2010 Loss of type III transforming growth factor-beta receptor expression is due to methylation silencing of the transcription factor GATA3 in renal cell carcinoma.
20178540 2010 Aberrantly increased mRNA expression of betaglycan, an inhibin co-receptor in the ovarian tissues in women with polycystic ovary syndrome.
20153821 2010 Roles for the type III TGF-beta receptor in human cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19842711 2009 Betaglycan has two independent domains required for high affinity TGF-beta binding: proteolytic cleavage separates the domains and inactivates the neutralizing activity of the soluble receptor.
19639191 2009 Down-regulation of transforming growth factor beta receptor type III in hepatocellular carcinoma is not directly associated with genetic alterations or loss of heterozygosity.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19416857 2009 The type III TGF-beta receptor regulates epithelial and cancer cell migration through beta-arrestin2-mediated activation of Cdc42.
19299629 2009 Sequencing of TGF-beta pathway genes in familial cases of intracranial aneurysm.
19249006 2009 Genome-wide association and follow-up replication studies identified ADAMTS18 and TGFBR3 as bone mass candidate genes in different ethnic groups.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19164448 2009 Loss of betaglycan contributes to the malignant properties of human granulosa tumor cells.
19131638 2009 Transforming growth factor-beta receptor-3 is associated with pulmonary emphysema.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18931647 2009 Hyperinsulinemic hypoglycemia with nesidioblastosis: histologic features and growth factor expression.
18845534 2008 Endocytosis of the type III transforming growth factor-beta (TGF-beta) receptor through the clathrin-independent/lipid raft pathway regulates TGF-beta signaling and receptor down-regulation.
18398939 2008 Abnormal transforming growth factor-beta expression in mesenchymal stem cells from patients with osteoarthritis.
18397882 2008 Suppression of inhibin A biological activity by alterations in the binding site for betaglycan.
18315732 2008 Distinct association of genetic variations of vascular endothelial growth factor, transforming growth factor-beta, and fibroblast growth factor receptors with atopy and airway hyperresponsiveness.
18299279 2008 Expression of the type III TGF-beta receptor is negatively regulated by TGF-beta.
18184661 2008 Bone morphogenetic proteins signal through the transforming growth factor-beta type III receptor.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18097622 2008 Expression of TGF-beta1 and its receptor genes (TbetaR I, TbetaR II, and TbetaR III-betaglycan) in peripheral blood leucocytes in patients with idiopathic pulmonary arterial hypertension and Eisenmenger's syndrome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17999987 2008 Loss of type III transforming growth factor beta receptor expression increases motility and invasiveness associated with epithelial to mesenchymal transition during pancreatic cancer progression.
17602227 2007 Detection of bone and cartilage-related proteins in plasma of patients with a bone fracture using liquid chromatography-mass spectrometry.
17408468 2007 Genetic polymorphisms associated with priapism in sickle cell disease.
17272393 2007 Inhibin A and B in vitro bioactivities are modified by their degree of glycosylation and their affinities to betaglycan.
17192875 2007 TGFBR3 loss and consequences in prostate cancer.
17084394 2007 Mutational analysis of betaglycan/TGF-betaRIII in premature ovarian failure.
16982625 2006 Identification of Tctex2beta, a novel dynein light chain family member that interacts with different transforming growth factor-beta receptors.
16886151 2006 Association of polymorphisms of IGF1R and genes in the transforming growth factor- beta /bone morphogenetic protein pathway with bacteremia in sickle cell anemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16621788 2006 Identification of distinct inhibin and transforming growth factor beta-binding sites on betaglycan: functional separation of betaglycan co-receptor actions.
16613887 2006 Mutational analysis of the betaglycan gene-coding region in susceptibility for ovarian failure.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15745937 2005 Inhibin alpha-subunit and the inhibin coreceptor betaglycan are downregulated in endometrial carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009106 2004 Genetic susceptibility to keloid disease: transforming growth factor beta receptor gene polymorphisms are not associated with keloid disease.
14704634 2004 Expression of TGF beta1 genes and their receptor types I, II, and III in low- and high-grade malignancy non-Hodgkin's lymphomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585090 2003 Expression of betaglycan in pregnant tIssues throughout gestation.
14557487 2003 Expression of betaglycan, an inhibin coreceptor, in normal human ovaries and ovarian sex cord-stromal tumors and its regulation in cultured human granulosa-luteal cells.
12970754 2003 Genomic profiling identifies alterations in TGFbeta signaling through loss of TGFbeta receptor expression in human renal cell carcinogenesis and progression.
12958365 2003 Beta-arrestin 2 mediates endocytosis of type III TGF-beta receptor and down-regulation of its signaling.
12873459 2003 Genetic susceptibility to Dupuytren's disease: transforming growth factor beta receptor (TGFbetaR) gene polymorphisms and Dupuytren's disease.
12782414 2003 Localization of activin and inhibin subunits, receptors and SMADs in the mouse mammary gland.
12651901 2003 Inhibin, activin, follistatin, activin receptors and beta-glycan gene expression in the placental tissue of patients with pre-eclampsia.
12568406 2003 Endoglin is expressed on human chondrocytes and forms a heteromeric complex with betaglycan in a ligand and type II TGFbeta receptor independent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12385827 2002 Properties of inhibin binding to betaglycan, InhBP/p120 and the activin type II receptors.
12358857 2002 Novel single nucleotide polymorphisms in the 3'-UTR of the TGFbetaRI and TGFbetaRIII genes.
11546783 2001 A novel mechanism for regulating transforming growth factor beta (TGF-beta) signaling. Functional modulation of type III TGF-beta receptor expression through interaction with the PDZ domain protein, GIPC.
11382746 2001 Real-time monitoring of the interactions of transforming growth factor-beta (TGF-beta ) isoforms with latency-associated protein and the ectodomains of the TGF-beta type II and III receptors reveals different kinetic models and stoichiometries of binding.
11323414 2001 Functional roles for the cytoplasmic domain of the type III transforming growth factor beta receptor in regulating transforming growth factor beta signaling.
11157754 2001 Type III TGF-beta receptor-independent signalling of TGF-beta2 via TbetaRII-B, an alternatively spliced TGF-beta type II receptor.
10944857 2000 Eleven single nucleotide polymorphisms and one triple nucleotide insertion of the human TGF-beta III receptor gene.
10746731 2000 Betaglycan binds inhibin and can mediate functional antagonism of activin signalling.
10207840 1999 Expression of transforming growth factor-beta receptors types II and III within various cells in the rat periodontium.
10092230 1999 Requirement of type III TGF-beta receptor for endocardial cell transformation in the heart.
8530052 1995 Assignment of human transforming growth factor-beta type I and type III receptor genes (TGFBR1 and TGFBR3) to 9q33-q34 and 1p32-p33, respectively.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8106553 1994 Betaglycan can act as a dual modulator of TGF-beta access to signaling receptors: mapping of ligand binding and GAG attachment sites.
7935686 1994 Transforming growth factor beta in tissue fibrosis.
1657407 1991 Expression cloning and characterization of the TGF-beta type III receptor.
1657406 1991 Structure and expression of the membrane proteoglycan betaglycan, a component of the TGF-beta receptor system.
1333192 1992 Molecular cloning and characterization of the human and porcine transforming growth factor-beta type III receptors.
1319842 1992 Receptors for the TGF-beta family.