Property Summary

NCBI Gene PubMed Count 46
PubMed Score 263.45
PubTator Score 64.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.4e-07
ovarian cancer 8491 2.0e-05
lung cancer 4473 1.4e-04
Disease Target Count Z-score Confidence
Body dysmorphic disorder 10 3.569 1.8
Alzheimer's disease 644 3.181 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.000 1.4e-07
lung cancer 1.600 1.4e-04
ovarian cancer 1.300 2.0e-05

Gene RIF (31)

PMID Text
26723877 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1 pathway.
25731772 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
25337247 LSF is an important mediator in colorectal carcinoma tumorigenesis and progression, and LSF expression is an important index for and prognostic prediction.
22396589 Antiproliferative small-molecule inhibitors of transcription factor LSF reveal oncogene addiction to LSF in hepatocellular carcinoma
22167195 Inhibition of MMP-9 significantly abrogated LSF-induced angiogenesis as well as in vivo tumorigenesis, thus reinforcing the role of MMP-9 in facilitating LSF function.
21876634 Data suggest that LSF is a key mediator of the Notch1 signaling pathway, suggesting that it might be a novel therapeutic target for the treatment of hepatocellular carcinoma.
21703197 Secreted OPN, induced by LSF, activates c-Met via a potential interaction between OPN and its cell surface receptor CD44. A significant correlation was observed among LSF, OPN, and activated c-Met levels in HCC.
20661472 Study show that CRTR-1 is generally an activator of transcription and that it modulates the activity of other family members, CP2, NF2d9 and altNF2d9, in a cell specific manner.
20404171 The expression of osteopontin (OPN), a gene regulating every step in tumor progression and metastasis, was robustly up-regulated by LSF.
19902333 SRY is a hybrid of DGCR8 and SOX3, and is regulated by the transcription factor CP2.
19889475 Observational study of gene-disease association. (HuGE Navigator)
18787404 The protein structure prediction of CP2 family in order to elucidate the molecular mechanism of the CP2-directed regulation of gene expression.
18629613 a novel mechanism by which RNF2 and PHB2 modulate the CP2-mediated transcriptional pathway.
18307033 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17902044 CP2/LBP-1c/LSF as a factor that likely mediates enhanced transcription of GARS-AIRS-GART in Down syndrome-related Alzheimer disease.
16710089 Observational study of gene-disease association. (HuGE Navigator)
16648487 The functional interaction of CP2 with GATA1 in the regulation of erythroid promoters was studied.
16272261 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16272261 LBP-1c/CP2/LSF may have a role in Alzheimer's disease
12661759 CP2 is a major factor in the regulation of globin expression in human and mouse erythroid cells, and CP2 binding to the globin gene promoter is essential for the enhanced transcription of globin genes in erythroid differentiation.
12555245 Observational study of gene-disease association. (HuGE Navigator)
12555245 Case control study indicates LSF polymorphism may have a moderate protective effect against the risk of Alzheimer's disease.
12393799 Mutation of a transcription factor, TFCP2L3, causes progressive autosomal dominant hearing loss, DFNA28
11940654 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
11865070 The human PcG protein dinG interacts with CP2, a mammalian member of the grainyhead-like family of transcription factors, in vitro and in vivo. The functional consequence of this interaction is repression of CP2-dependent transcription
11574690 Activates Exon 1 Enhancer of Pax6 along with Sp1
11283204 Observational study of gene-disease association. (HuGE Navigator)
10888618 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
10455131 Positively regulates Serum Amyloid A3 (SAA3). Identified as SAA3 Enhancer Factor (SEF).
9371597 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
8289393 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter

AA Sequence

MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDNENKILPFQYV      1 - 70
LCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRVVFHDRRLQYTEHQQLEGW     71 - 140
RWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPAKRTSVFIQVHCISTEFTMRKHGGEKGVPFR    141 - 210
VQIDTFKENENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPW    211 - 280
PEITYVNNSPSPGFNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFT    281 - 350
NFSGADLLKLTRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS    351 - 420
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMK    421 - 490
AETNDSYHIILK                                                              491 - 502
//

Text Mined References (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26723877 2016 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1.
25416956 2014 A proteome-scale map of the human interactome network.
25337247 2014 LSF expression and its prognostic implication in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22396589 2012 Antiproliferative small-molecule inhibitors of transcription factor LSF reveal oncogene addiction to LSF in hepatocellular carcinoma.
22167195 2012 Late SV40 factor (LSF) enhances angiogenesis by transcriptionally up-regulating matrix metalloproteinase-9 (MMP-9).
21876634 2011 Late SV40 factor: a key mediator of Notch signaling in human hepatocarcinogenesis.
21703197 2011 c-Met activation through a novel pathway involving osteopontin mediates oncogenesis by the transcription factor LSF.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20661472 2010 Modulation of CP2 family transcriptional activity by CRTR-1 and sumoylation.
20404171 2010 Transcription factor Late SV40 Factor (LSF) functions as an oncogene in hepatocellular carcinoma.
19902333 2010 The male-determining gene SRY is a hybrid of DGCR8 and SOX3, and is regulated by the transcription factor CP2.
19889475 2011 No replication of genetic association between candidate polymorphisms and Alzheimer's disease.
18787404 2008 The fold recognition of CP2 transcription factors gives new insights into the function and evolution of tumor suppressor protein p53.
18629613 2008 PHB2 interacts with RNF2 and represses CP2c-stimulated transcription.
18307033 2009 Cluster analysis of risk factor genetic polymorphisms in Alzheimer's disease.
18164103 2008 Interactions between the products of the Herpes simplex genome and Alzheimer's disease susceptibility genes: relevance to pathological-signalling cascades.
17902044 2007 Potential interaction between the GARS-AIRS-GART Gene and CP2/LBP-1c/LSF transcription factor in Down syndrome-related Alzheimer disease.
17456737 2007 GeneChip, geNorm, and gastrointestinal tumors: novel reference genes for real-time PCR.
16973241 2007 Convergence of genes implicated in Alzheimer's disease on the cerebral cholesterol shuttle: APP, cholesterol, lipoproteins, and atherosclerosis.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710089 2006 Association of polymorphism in the transcription factor LBP-1c/CP2/LSF gene with Alzheimer's disease and major depression.
16648487 2006 Functional interaction of CP2 with GATA-1 in the regulation of erythroid promoters.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16272261 2005 Further evidence for LBP-1c/CP2/LSF association in Alzheimer's disease families.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12661759 2003 CP2 binding to the promoter is essential for the enhanced transcription of globin genes in erythroid cells.
12555245 2003 Association of the 3' UTR transcription factor LBP-1c/CP2/LSF polymorphism with late-onset Alzheimer's disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393799 2002 Mutation of a transcription factor, TFCP2L3, causes progressive autosomal dominant hearing loss, DFNA28.
11940654 2002 Counterregulation of chromatin deacetylation and histone deacetylase occupancy at the integrated promoter of human immunodeficiency virus type 1 (HIV-1) by the HIV-1 repressor YY1 and HIV-1 activator Tat.
11865070 2002 Binding of the RING polycomb proteins to specific target genes in complex with the grainyhead-like family of developmental transcription factors.
11574690 2001 Activation of the human PAX6 gene through the exon 1 enhancer by transcription factors SEF and Sp1.
11283204 2001 Genetic association of an LBP-1c/CP2/LSF gene polymorphism with late onset Alzheimer's disease.
11003662 2000 Induction of human fetal globin gene expression by a novel erythroid factor, NF-E4.
11001930 2000 The transcriptional factor LBP-1c/CP2/LSF gene on chromosome 12 is a genetic determinant of Alzheimer's disease.
10888618 2000 The human factors YY1 and LSF repress the human immunodeficiency virus type 1 long terminal repeat via recruitment of histone deacetylase 1.
10455131 1999 Purification and characterization of the serum amyloid A3 enhancer factor.
9685356 1998 The Fe65 adaptor protein interacts through its PID1 domain with the transcription factor CP2/LSF/LBP1.
9371597 1997 Repression of human immunodeficiency virus type 1 through the novel cooperation of human factors YY1 and LSF.
8586452 1995 The human transcription factor CP2 (TFCP2), a component of the human gamma-globin stage selector protein, maps to chromosome region 12q13 and is within 250 kb of the NF-E2 gene.
8157699 1994 Characterization of the genomic structure, chromosomal location, promoter, and development expression of the alpha-globin transcription factor CP2.
8114710 1994 Characterization of a family of related cellular transcription factors which can modulate human immunodeficiency virus type 1 transcription in vitro.
8035790 1994 One exon of the human LSF gene includes conserved regions involved in novel DNA-binding and dimerization motifs.
7828600 1995 Hemoglobin switching in man and chicken is mediated by a heteromeric complex between the ubiquitous transcription factor CP2 and a developmentally specific protein.
1732747 1992 Molecular cloning of the alpha-globin transcription factor CP2.