Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.71
PubTator Score 5.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sleeping sickness 37 3.427 1.7

Expression

AA Sequence

MSAKRAELKKTHLSKNYKAVCLELKPEPTKTFDYKAVKQEGRFTKAGVTQDLKNELREVREELKEKMEEI      1 - 70
KQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRP     71 - 140
KKMDGASGVNGAPCALHKKTMAPQKTKQGSLDPLHHCGTCCEKCLLCALKNNYNRGNIPSEASGLYKGGE    141 - 210
EPVTTQPSVGHAVPAPKSQTEGR                                                   211 - 233
//

Text Mined References (11)

PMID Year Title