Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.60
PubTator Score 1.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Orofaciodigital syndrome 4 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Joubert syndrome 66 4.326 2.2

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.9e-07
atypical teratoid / rhabdoid tumor 1.500 3.8e-08
ependymoma 1.100 7.2e-03
glioblastoma 1.100 3.8e-02
lung cancer 1.100 3.6e-02
ovarian cancer -1.500 2.6e-08
pediatric high grade glioma 1.100 4.7e-06

Gene RIF (2)

AA Sequence

MRTPQLALLQVFFLVFPDGVRPQPSSSPSGAVPTSLELQRGTDGGTLQSPSEATATRPAVPGLPTVVPTL      1 - 70
VTPSAPGNRTVDLFPVLPICVCDLTPGACDINCCCDRDCYLLHPRTVFSFCLPGSVRSSSWVCVDNSVIF     71 - 140
RSNSPFPSRVFMDSNGIRQFCVHVNNSNLNYFQKLQKVNATNFQALAAEFGGESFTSTFQTQSPPSFYRA    141 - 210
GDPILTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLASSCTLDSALNAASYYNF    211 - 280
TVLKVPRSMTDPQNMEFQVPVILTSQANAPLLAGNTCQNVVSQVTYEIETNGTFGIQKVSVSLGQTNLTV    281 - 350
EPGASLQQHFILRFRAFQQSTAASLTSPRSGNPGYIVGKPLLALTDDISYSMTLLQSQGNGSCSVKRHEV    351 - 420
QFGVNAISGCKLRLKKADCSHLQQEIYQTLHGRPRPEYVAIFGNADPAQKGGWTRILNRHCSISAINCTS    421 - 490
CCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSLTTLVNFVDITQKPQPPRGQP    491 - 560
KMDWKWPFDFFPFKVAFSRGVFSQKCSVSPILILCLLLLGVLNLETM                           561 - 607
//

Text Mined References (14)

PMID Year Title