Property Summary

NCBI Gene PubMed Count 46
PubMed Score 207.96
PubTator Score 312.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 7.800 0.0e+00
osteosarcoma -5.348 2.9e-08
medulloblastoma, large-cell 1.300 1.6e-03
Atopic dermatitis 1.800 1.6e-02
primary pancreatic ductal adenocarcinoma 2.161 1.3e-03
non-small cell lung cancer 1.311 5.0e-05
active Crohn's disease 4.021 1.2e-03
active ulcerative colitis 5.495 4.5e-03
pancreatic cancer 2.700 2.9e-04
interstitial cystitis 3.300 6.3e-03
cystic fibrosis and chronic rhinosinusit... 2.809 1.1e-02
lung adenocarcinoma 2.200 8.3e-04
Breast cancer -3.900 2.0e-09
mucosa-associated lymphoid tissue lympho... 3.534 3.6e-02
chronic rhinosinusitis 3.240 3.1e-03

Gene RIF (30)

PMID Text
24057896 Levels of holotranscobalamin are decreased patients with cobalamin deficiency.
23846701 Structural basis for universal corrinoid recognition by the cobalamin transport protein haptocorrin.
23670528 TCN1 gene expression implicates disease progression in patient with middle ear cholesteatoma.
22872637 comparison of human and rainbow trout cobalamin-binding protein
22306884 Elevated concentrations of B(12) found in autoimmune lymphoproliferative syndrome patients were due to increased lymphocyte expression of haptocorrin.
21574054 Stromal expression of KRT15, TCN1, and HOXB13 was significantly correlated with tumor grade, stromal hypercellularity, mitotic activity and microscopic borders.
20852008 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20216556 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20082058 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19729796 Maternal folate-related polymorphisms studied here (CBS, MTR, RFC-1, and TC) have no influence on trisomy 21 susceptibility in subjects of Brazilian population.v
19686235 two novel mutations, each causing a premature stop codon - a genetic basis for TC I deficiency
18830263 Observational study of gene-disease association. (HuGE Navigator)
18485163 Observational study of gene-disease association. (HuGE Navigator)
17891500 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17487979 interactions of COBALAMIN BINDING proteins with a number of ligands
16470748 Observational study of gene-disease association. (HuGE Navigator)
16268464 Observational study of gene-disease association. (HuGE Navigator)
15941899 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15834031 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15201366 Observational study of gene-disease association. (HuGE Navigator)
15073531 Observational study of gene-disease association. (HuGE Navigator)
14739547 Observational study of gene-disease association. (HuGE Navigator)
14656021 Observational study of gene-disease association. (HuGE Navigator)
12923155 Observational study of gene-disease association. (HuGE Navigator)
12590948 No association between the MTHFR A1298C and transcobalamin C776G genetic polymorphisms and hyperhomocysteinemia in thrombotic disease.
12194912 Observational study of gene-disease association. (HuGE Navigator)
11788601 Comparative analysis of cobalamin binding kinetics

AA Sequence

MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQT      1 - 70
LMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTP     71 - 140
LTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKAD    141 - 210
EGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA    211 - 280
FSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV    281 - 350
TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV    351 - 420
RNGENLEVRWSKY                                                             421 - 433
//

Text Mined References (48)

PMID Year Title
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24587374 2014 Transcriptomic profile reveals gender-specific molecular mechanisms driving multiple sclerosis progression.
24057896 2014 Role of serum holotranscobalamin (holoTC) in the diagnosis of patients with low serum cobalamin. Comparison with methylmalonic acid and homocysteine.
23846701 2013 Structural basis for universal corrinoid recognition by the cobalamin transport protein haptocorrin.
23670528 2013 Differential gene expression in cholesteatoma by DNA chip analysis.
22872637 2012 A single rainbow trout cobalamin-binding protein stands in for three human binders.
22306884 2012 Elevated vitamin B?? levels in autoimmune lymphoproliferative syndrome attributable to elevated haptocorrin in lymphocytes.
21574054 2012 Keratin 15, transcobalamin I and homeobox gene Hox-B13 expression in breast phyllodes tumors: novel markers in biological classification.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20216556 2010 Transcobalamin C776G genotype modifies the association between vitamin B12 and homocysteine in older Hispanics.
20082058 2010 Transcobalamin-II variants, decreased vitamin B12 availability and increased risk of frailty.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19744961 2009 Genome-wide significant predictors of metabolites in the one-carbon metabolism pathway.
19729796 2009 Investigation of CBS, MTR, RFC-1 and TC polymorphisms as maternal risk factors for Down syndrome.
19686235 2009 Genomic mutations associated with mild and severe deficiencies of transcobalamin I (haptocorrin) that cause mildly and severely low serum cobalamin levels.
19303062 2009 Genome-wide association study of vitamin B6, vitamin B12, folate, and homocysteine blood concentrations.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18485163 2008 Folic acid use in pregnancy and embryo selection.
17891500 2007 One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia.
17487979 2007 Mechanisms of discrimination between cobalamins and their natural analogues during their binding to the specific B12-transporting proteins.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16470748 2006 Study of four genes belonging to the folate pathway: transcobalamin 2 is involved in the onset of non-syndromic cleft lip with or without cleft palate.
16341674 2005 Transcriptome analysis of human gastric cancer.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16268464 2005 Association of MTRRA66G polymorphism (but not of MTHFR C677T and A1298C, MTRA2756G, TCN C776G) with homocysteine and coronary artery disease in the French population.
15941899 2005 Transcobalamin 776C->G polymorphism negatively affects vitamin B-12 metabolism.
15834031 2005 Homocysteine and related genetic polymorphisms in Down's syndrome IQ.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15201366 2004 Association of IL-1 RN*2 allele and methionine synthase 2756 AA genotype with dementia severity of sporadic Alzheimer's disease.
15073531 2004 Homocysteine and methylenetetrahydrofolate reductase polymorphism in Alzheimer's disease.
14739547 2004 Transcobalamin polymorphism and serum holo-transcobalamin in relation to Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656021 2003 The role of genetic factors in the development of hyperhomocysteinemia.
12923155 2003 Gene-gene interaction between fetal MTHFR 677C>T and transcobalamin 776C>G polymorphisms in human spontaneous abortion.
12590948 2002 No association between the MTHFR A1298C and transcobalamin C776G genetic polymorphisms and hyperhomocysteinemia in thrombotic disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194912 2002 Polymorphisms in the transcobalamin gene: association with plasma homocysteine in healthy individuals and vascular disease patients.
11788601 2002 Comparative analysis of cobalamin binding kinetics and ligand protection for intrinsic factor, transcobalamin, and haptocorrin.
11717507 2001 Crystallization and preliminary X-ray diffraction analysis of human transcobalamin, a vitamin B12-transporting protein.
11373332 2001 Transcellular transport of vitamin B(12) in LLC-PK1 renal proximal tubule cells.
2777761 1989 Structure of the cDNA encoding transcobalamin I, a neutrophil granule protein.
1463480 1992 Genomic structure and mapping of the chromosomal gene for transcobalamin I (TCN1): comparison to human intrinsic factor.
1176444 1975 Human plasma R-type vitamin B12-binding proteins. I. Isolation and characterization of transcobalamin I. TRANSCOBALAMIN III. and the normal granulocyte vitamin B12-binding protein.