Property Summary

NCBI Gene PubMed Count 566
PubMed Score 439.73
PubTator Score 651.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 5.955 3.0
Disease Target Count Z-score Confidence
Obesity 616 3.69 1.8

Expression

  Differential Expression (36)

Disease log2 FC p
Rheumatoid Arthritis 2.400 3.7e-03
pancreatic cancer -1.300 4.6e-03
malignant mesothelioma 1.300 2.7e-05
astrocytoma 2.600 3.5e-03
ependymoma 2.100 6.3e-03
oligodendroglioma 1.900 1.4e-03
esophageal adenocarcinoma 1.300 1.8e-02
psoriasis -3.200 3.1e-05
osteosarcoma 3.522 2.8e-07
atypical teratoid / rhabdoid tumor 3.000 1.6e-08
glioblastoma 3.400 8.2e-08
medulloblastoma, large-cell -1.600 3.6e-02
primitive neuroectodermal tumor 2.600 1.8e-02
Duchenne muscular dystrophy 1.373 2.3e-06
autosomal dominant Emery-Dreifuss muscul... 1.547 1.9e-03
juvenile dermatomyositis 1.273 4.3e-11
Amyotrophic Lateral Sclerosis 1.016 7.5e-05
Atopic dermatitis -1.200 5.7e-04
intraductal papillary-mucinous adenoma (... 1.900 3.4e-03
intraductal papillary-mucinous carcinoma... 1.800 4.6e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.0e-02
breast carcinoma -1.400 4.0e-40
interstitial cystitis -1.100 3.3e-03
pediatric high grade glioma 2.300 7.7e-04
group 4 medulloblastoma -2.500 3.2e-04
pilocytic astrocytoma 1.500 2.7e-02
non primary Sjogren syndrome sicca -1.200 1.5e-02
pancreatic carcinoma -1.300 4.6e-03
aldosterone-producing adenoma -1.014 2.0e-02
invasive ductal carcinoma -1.700 2.6e-02
Breast cancer -2.000 9.2e-16
lung carcinoma -2.200 3.7e-30
Pick disease 1.300 4.6e-04
ovarian cancer 1.800 1.1e-04
pituitary cancer -2.700 5.4e-07
dermatomyositis 1.800 4.5e-04

Gene RIF (622)

PMID Text
27058589 The T allele of TCF7L2 rs7903146 polymorphism was associated with susceptibility of gestational diabetes mellitus in overall population in white, Hispanic/Latino and Asian sub-groups. Meta-analysis.
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26986145 polymorphism may contribute to the risk of diabetic nephropathy
26934194 The strongest evidence of the TCF7L2 - Body Mass Index interaction was observed for rs7895307 SNP.
26914832 Despite limited sample size, the study indicates that rs7903146-T allele in TCF7L2 was associated with higher mean nocturnal glucose dependent on body composition, which might suggest that rs7902146 affects liver-specific aspects of glucose metabolism.
26681031 Meta-analysis revealed that the T allele of rs7903146 was also correlated with T2DM susceptibility.
26608632 Data indicate that triglycerides were significantly associated with the T risk allele of the transcription factor 7-like 2 (TCF7L2) gene.
26604685 this study demonstrates the presence of the rs7903146 polymorphism in the Iranian population, suggesting susceptibility to type 2 diabetes
26576435 Our meta-analysis indicated the association between TCF7L2 rs7903146 polymorphism and low plasma triglyceride (TG) level in subjects with type 2 diabetes.
26536002 Transcription factor 7-like 2 (TCF7L2) gene encodes the TCF-4 transcription factor, which forms a part of the Wnt signaling pathway.
26525881 A genetic variant harbored within the TCF7L2 locus rs7903146 impairs glucose tolerance through effects on glucagon as well as on insulin secretion.
26393635 The data suggested that the genetic polymorphisms of the TCF7L2 gene were associated with T2DM in the Uygur population of China.
26367734 rs12255372 and rs4506565 variants(but not rs7903146) of TCF7L2 show an association with type 2 diabetes mellitus for the Saudi population of the Eastern Province of Saudi Arabia
26345943 the TCF7L2 rs12255372 (G>T) polymorphism might be one of the most important genetic factors associated with T2DM susceptibility.
26316572 provides substantial evidence that the rs7903146 variant is significantly associated with the risk of diabetic retinopathy in Caucasian populations
26273662 TCF7L2 rs10885409 C allele is a T2DM risk factor in Emiratis; this association is modulated by obesity status, but the Pro12Ala mutation in PPAR-gamma2 is not associated with T2DM risk in this population
26247673 there is no significant association between the rs11196218A/G polymorphism and the risk of type 2 diabetes mellitus in the Chinese Han population.
26109524 TCF7L2 was associated with increased risk of impaired glucose metabolism.
26102344 The T-allele frequencies of TCF7L2 polymorphisms rs12255372 and rs7903146 were 30% (26-35%), 32% (27-37%) and 29% (25-34%), 36% (31-41%), respectively.
26058934 The rs12255372 SNP of TCF7L2 and D76N of PDX-1 genes may confer susceptibility to T2DM in the population living in Mashhad, Iran.
26046964 In subjects at risk for T2 Diabetes mellitus the TCF7L2 polymorphisms were associated with reduced Rate of appearance of exogenous glucose into systemic circulation, causing reduced postprandial blood glucose increase and lower insulin secretion rate.
25946847 TCF7L2 gene polymorphism of geriatric patients with coronary heart disease contributes to development of a metabolic syndrome and reduces term of their life.
25934528 The T-Allele of the TCF7L2 rs7903146 is a significantly risk factor for impaired proinsulin conversion. [Meta-analysis]
25867435 Studies indicate that TCF7L2 transcription factor gene polymorphisms were significantly associated with an increased risk of breast cancer.
25863010 no association of single nucleotide polymorphisms and type 2 diabetes mellitus susceptibility in Chinese population
25678841 Our results support a genetic interaction in the TCF7L2 SNPs as a predictor of disease recurrence after curative RP in localized prostate cancer patients.
25678248 There were no significant associations between polycystic ovary syndrome and TCF7L2 rs7903146 or rs12255372 polymorphisms--{REVIEW}
25627047 results confirm the association between the TCF7L2 rs7903146 polymorphism and increase risk for type 2 diabetes in Southern-Brazil.
25498973 there is a putative genetic connection between TCF7L2 and EXT in the context of Hereditary Multiple Exostoses
25491720 The T allele of the TCF7L2 rs7903146 SNP is associated with a significantly higher risk of type 2 diebtes in an Algerian population.
25483131 The results support a central role of CDKAL1 and TCF7L2 in T2DM susceptibility in Southwest Asian populations and provide a plausible component for understanding molecular mechanisms involved in the disease.
25398947 Tcf7l2 may play key role in glucose metabolism through actions beyond pancreatic beta cells.
25353718 The TCF7L2 rs7903146 TT/TC genotype was associated with lower levels of total cholesterol, low-density lipoprotein, and high-density lipoprotein in hepatitis C genotype3 HIV coinfected patients.
25299103 data suggest that the TCF7L2 SNPs rs7903146 and rs12255372 may not significantly contribute to T2D susceptibility in this population
25274455 This study suggests that the SNP rs1800592 in the UCP1 gene is associated with increased risk of PDR in the Chinese type 2 diabetes mellitus population.
25224167 TCF7 L2 gene variation affected the decrease of fasting blood glucose after gastric bypass in obese patients with type 2 diabetes, independently of weight loss.
25185853 Pooled meta-analysis of studies on rs7903146 and T2DM confirmed that rs7903146 is significantly associated with susceptibility to T2DM in Indian populations
25185411 The T-allele of rs12255372, rs7903146, and rs290487 polymorphisms of TCF7L2 confer susceptibility to T2DM in the Kurdish population of Iran
25131200 The intestine-specific transcription factor CDX2 and Wnt effector TCF7L2 bind near rs16969681, with significantly higher affinity for the colorectal cancer risk allele.
25117344 there is no risk of diabetic retinopathy among individuals with the TCF7L2 polymorphisms rs7903146.
25102180 We identified three known loci (TCF7L2, HMGA2 and KCNQ1) and two novel loci (HLA-B and INS-IGF2) at genome-wide significance (4.15 x 10(-94)
25058603 in human immortalized lymphocytes carrying the at-risk T/T genotype, first the differential expression of TCF7L2 splice variants implies a regulation, at least for exon 4, by TRA2B
25048152 TCF7L2 rs4506565 variant (T/T) is associated with increased risk of gestational diabetes mellitus (GDM) and plasma resistin concentrations in women with GDM.
25034524 LHX4 facilitate TCF4 to bind to beta-catenin and form a stable LHX4/TCF4/beta-catenin complex and transactive its downstream target gene
25015099 Tcf7l2 is regulating proinsulin expression directly via Isl1, Ins1 and indirectly via MafA, NeuroD1 and Pdx1.
25001176 SOX10 facilitates TCF4 to bind to beta-catenin and form a stable SOX10/TCF4/beta-catenin complex and trans-activate its downstream target gene in human hepatocellular carcinoma
24982424 study suggests that CREPT acts as an activator to promote transcriptional activity of the beta-catenin.TCF4 complex in response to Wnt signaling.
24961829 Among hyperglycemic men, a risk allele in TCF7L2 may increase the risk of prostate cancer.
24925104 Data suggest that the ranscription factor 7-like 2 variant rs7903146 (TCF7L2 rs7903146) to the pathogenesis of type 2 diabetes can still be seen as a mechanism impairing insulin secretion.
24914535 Methylation in TCF7L2 promoter is further correlated with fasting glucose in peripheral blood DNA, which sheds new light on the role of epigenetic regulation of TCF7L2 in type 2 diabetes.
24864085 This study found no association between rs7903146 polymorphism in the TCF7L2 gene and the increased risk for development of CKD caused by primary glomerulopathy and analysed tubulointerstitial nephropathy.
24815492 The findings of this systemic analysis suggest that the polymorphism of TCF7L2 rs7903146 may not be associated with the susceptibility to polycystic ovary syndrome.
24667787 Our results point to a protein complex binding across rs7903146 within TCF7L2 and suggests a possible mechanism by which this locus confers its T2D risk.
24639413 genetic association studies in population of pregnant women in Mexico: Data suggest that SNPs in TCF7L2 are associated with gestational diabetes in the population studied; SNP rs12255372 is strongly associated; SNP rs7903146 is marginally associated.
24611738 TCF7L2 genetic polymorphisms may contribute to susceptibility to polycystic ovary syndrome, especially for the rs7903146 C-->T polymorphism among Caucasians and Asians
24605829 Data suggest up-regulation of TCF4 (T cell transcription factor 4) expression and Wnt signaling play roles in placentation; induction/nuclear recruitment of TCF4 and coactivator beta-catenin are exhibited in conditions promoting trophoblast motility.
24574000 We described for the first time a strong relationship between the TCF7L2 gene variant rs7903146 and cardiovascular disease in end-stage renal disease patients.
24529562 Transcription factor 7-like 2 gene polymorphism rs7903146 is associated with stroke in type 2 diabetes.
24518834 the rs12255372 SNP shows a weaker association with type 2 diabetes compared with rs7903146
24485399 TCF7L2 rs7903146 Polymorphism is associated with Diabetes Mellitus, Type 2.
24463962 Alternative human liver transcripts of TCF7L2 bind to the gluconeogenesis regulator HNF4alpha at the protein level.
24338422 Association of rs7014346 in POU5F1P1, rs989902 in PTPN13, and rs7003146 in TCF7L2 with variations in the risk of breast cancer in a Chinese Han population.
24322204 Investigation of the genetic factors underlying bipolar disorder, results show strong evidence of a SNP-body mass index interaction involving a variant in TCF7L2 at the genome-wide level
24266846 A meta-analysis suggests that the TCF7L2 rs12255372 T allele is a low-penetrant risk factor for breast carcinogenesis.
24214952 Positive significant association between impairment in wound healing of diabetic foot ulcers and the TT genotype of rs7903146 (C/T) variant of TCF7L2 gene was found in a north Indian population.
24205231 Carriers of TCF7L2 rs7903146 exhibited a non-significant increase of plasma sphingomyelins.
24162774 Expression of TCF-4 in human astrocytic cells decreased HIV-1 Tat-mediated transcription of the HIV-1 LTR, while GST pull-down assays revealed a direct interaction of Tat with TCF-4, suggesting TCF-4 may regulate the level of HIV-1 gene transcription
24157263 There is weak or no contribution of TCF7L2 gene polymorphism to polycystic ovary syndrome in Tunisian women.
24128935 results suggest that hydrochlorothiazide (HCTZ)-associated new onset diabetes; observations suggest that an environmental risk factor such as HCTZ treatment further increases diabetes risk in TCF7L2 risk allele carriers
24072042 Data indicate transcription factor TCF7L2 as a regulator of KIBRA gene expression.
24059590 The TCF7L2 (T) allele was increased in the type 2 diabetes group (0.36) compared to the controls
24002895 we have found no association between TCF7L2 and type 2 diabetes in Chinese population
23977356 Marked expression of TCF7L2 in oligodendrocytes is restricted to a well defined time period during developmental myelination in human and mouse central nervous system tissue samples.
23951231 Significant associations have been found between the TCF7L2 rs7903146 polymorphisms and the risk for breast, prostate and colon cancers. (Meta-analysis)
23942586 this study investigated whether the TCF7L2-rs7903146 (C>T) polymorphism associations with type 2 diabetes, glucose, lipids, and cardiovascular disease incidence were modulated by MedDiet.
23935130 TCF7L2 variants are probably not implicated in polycystic ovary syndrome development in South Brazilian women
23926018 compared with the control group. CONCLUSION: The T allele of SNP rs7903146 of TCF7L2 gene is a risk factor for metabolic syndrome in Chinese Korean and Han populations from Yanbian.
23855352 The meta-analysis suggests that TCF7L2 rs7903146 genetic polymorphism was associated with increased risk of gestational diabetes mellitus.
23844215 Data indicate that henryin impaired the association of beta-catenin/TCF4 transcriptional complex likely through directly blocking the binding of beta-catenin to TCF4.
23840876 GRG5/AES interacts with TCF4 and represses Wnt-mediated transcription both in human cells and zebrafish embryos.
23670970 SNPs in TCF7L2 was replicated in this study (P = 0.004; combined analysis P = 3.8 x 10(-6)), and type 2 diabetes SNPs at or near CDKAL1, CDKN2A/B, and IGF2BP2 were associated with CFRD
23651211 The consequence of TCF-4J isoform expression was upregulation of genes associated with tripartite Wnt/beta-catenin, insulin/IGF-1/IRS1 and Notch signal transduction pathway activation, which contribute to the pathogenesis of hepatocellular carcinoma.
23648141 The TCF-4C isoform lacking exon 4 is associated with a malignant phenotype compared with the exon 4-harbouring TCF-4D isoform, indicating that exon 4 of TCF-4 plays a prominent role in hepatocellular carcinoma development.
23617586 results suggest synergistic effects of WNT16a insertion and the at-risk 'T' allele of TCF7L2 (rs7903146) for elevating the expression of TCF7L2 in human pancreas which may affect the regulation of downstream target genes involved in the development of T2D
23613959 acetylation of TCF4E is a novel regulatory mechanism that diversifies the transcriptional output of Wnt/beta-catenin signaling
23603903 Increased TCF4 expression may contribute to cartilage degeneration in osteoarthritis by augmenting NF-kappaB signaling.
23579632 by pooling all available qualified data from genetic studies on rs12255372 and T2DM, we have confirmed that rs12255372 is significantly associated with susceptibility to T2DM in the global population.
23577093 strong association of the TCF7L2 SNPs with type 2 diabetes mellitus
23558246 TCF7L2 polymorphisms were associated with HD and maybe cancer risk as well.
23536853 the genotypes of rs7903146 (IVS3C/T) in TCF7L2 have no major impact on T2DM; the CC genotype and the recessive model of rs290487 (IVS3C/T) and the haplotype CC of rs7903146 (IVS3C/T) and rs290487 (IVS3C/T) in TCF7L2 gene are associated with T2DM.
23527206 The rs7903146C/T polymorphism of the TCF7L2 gene had a significant effect on type 2 diabetes risk in a Chinese Han population.
23504200 ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway.
23437103 The transcriptional activity of the ABCD2 promoter was strongly increased by ectopic expression of beta-catenin and TCF-4.
23434931 TCF7L2-rs7903146 is associated with diabetic nephropathy in Caucasian type 2 diabetes and suggest that TCF7L2 promotes pathological retinal neovascularization via ER stress-dependent upregulation of VEGFA.
23395167 the LRP6(R611C) mutation diminishes TCF7L2-dependent transcription of the IR while it increases the stability of IGFR and enhances mTORC1 activity.
23349771 Data indicate associations of SNPs in eight loci CXCR4, HHEX, FOXA2, NGN3, TCF7L2, FLJ39370 (C4orf32), LOC646279 (RPL21P7) and THADA with body mass index (BMI) and weight.
23311683 TCF7L2 single nucleotide polymorphisms are associated with increased susceptibility to type 2 diabetes mellitus.
23306204 SOX9 regulates low density lipoprotein receptor-related protein 6 (LRP6) and T-cell factor 4 (TCF4) expression and Wnt/beta-catenin activation in breast cancer.
23295773 Activation of TCF4 is associated with glioblastoma multiforme.
23295285 We found that the T allele of the SNP rs7903146 of TCF7L2 was significantly associated with type 2 diabetes risk (odds ratio of 3.92 for genotype TT in the recessive genetic model, p = 0.004 and 1.5 for T allele, p = 0.032).
23224985 Nuclear TCF4 correlate with cerebral metastasis of lung adenocarcinomas.
23193183 Data suggest that an SNP in TCF7L2 (rs7903146) is associated with type 2 diabetes in African Americans. [META-ANALYSIS; Genome-Wide Association Studies]
23188737 increase in the risk of type 2 diabetes with rs7903146, rs12255372, rs11196205, rs7901695, rs7895340 and rs4506565 but not with rs11196218 or rs290487 single-nucleotide polymorphisms
23152614 Expression of TCF-4 in human astrocytic cells decreased HIV-1 Tat-mediated transcription of the HIV-1 LTR, while GST pull-down assays revealed a direct interaction of Tat with TCF-4, suggesting TCF-4 may regulate the level of HIV-1 gene transcription
23144361 In African Americans, seven of the 29 SNPs examined were found to be associated with T2D risk at P </= 0.05, including rs7903146 (TCF7L2).
23142382 The strong contribution of TCF7L2 gene variants to type 2 diabetes among Tunisians
23107111 genome-wide association study in an Arab population in Lebanon: Data suggest that 7 SNPs in TCF7L2 (rs7901695; rs4506565; rs7903146; rs12243326; rs7895340; rs11196205; rs12255372) are strongly associated with type 2 diabetes.
23086040 Data suggest that TCF7L2 splicing in abdominal adipose tissue is regulated by weight loss and is associated with obesity, hyperglycemia, and high levels of serum free fatty acids.
23085767 there is a significant association between the TCF7L2 gene and risk of breast cancer regardless of ethnicity and/or Native American ancestry.
23050589 Data indicate no association was found between the IVS4G>T mutation in the TCF7L2 gene and diabetes.
23041303 Donor TCF7L2 rs290487 polymorphism is associated with an increased risk of new-onset diabetes mellitus (NODM) after liver transplantation and has a potential clinical value for the prediction of NODM.
23034957 Individuals with the TCF7L2 rs12255372 risk genotype may reduce body adiposity by consuming a diet lower in total fat.
23030478 TCF4 was significantly overexpressed in hepatocellular carcinoma.
23029137 Tcf-4 knockdown shows better efficacy for inhibiting proliferation and inducing apoptosis of colorectal cancer cells, which may be related to increased FOXO4 transcriptional activity
23014255 The absence of any difference between genotype frequencies among study groups indicates that no association persists with TCF7L2 gene rs7903146 polymorphism and type 2 diabetes mellitus.
23011354 investigation of involvement of an SNP TCF7L2 (rs7903146; previously identified in genome-wide association studies), cis-regulatory elements, and chromatin assembly and disassembly in genetic/epigenetic predisposition to type 2 diabetes
23010200 the rs7903146 T allele was associated with an increased risk for T2DM, but the rs290487 C allele is not associated with T2DM in the Chinese Han population.
22967502 Data suggest that TCF7L2 and Wnt signaling are negative regulators of gluconeogenesis in hepatocytes; TCF7L2 is among the downstream effectors of insulin in hepatocytes; insulin stimulates TCF7L2 expression in hepatocytes.
22951069 TCF7L2 binds GATA3 and represses transcription at a subset of sites in MCF7 cells.
22945304 Study demonstrates that TCF7L2 overexpression fosters beta cell regeneration. Findings imply correlation of TCF7L2 levels and new beta cell formation.
22942101 Single nucleotide polymorphisms rs7895340 and rs11196205 of TCF7L2 showed a significant association with type 2 diabetes mellitus in Thai patients.
22923468 rs7754840 (CDKAL1) was associated in the nonobese type 2 diabetic subgroup, and for rs7903146 (TCF7L2), association was observed for early-onset type 2 diabetes.
22916254 Healthy young males and elderly persons who are carriers of the mutant allele for rs7903146 have an impaired postprandial lipid metabolism that may be mediated by an alteration in adipokine regulation, and may be related to the higher cardiovascular risk.
22911383 TCF7L2 rs7903146 impairs islet function and morphology in non-diabetic individuals.
22885420 The distribution of CC, CT and TT genotypes of SNP rs7903146 of the TCF7L2 gene was not different between patients and controls, and no association between the genotype and indicators of disease severity or smoking history was found
22862926 Findings suggest that the effect of TCF7L2 on diabetes risk may include reduced secretion of GIP (glucose-dependent insulinotropic polypeptide).
22843023 In addition to the involvement of TCF7L2 in Type 2 diabetes mellitus, TCF7L2 genetic variability also contributes to the development of diabetic complications such as retinopathy and cardiovascular autonomic neuropathy.
22805760 A correlation was observed between D-glucuronyl C5-epimerase (GLCE), TCF4 and beta-catenin expression in breast cancer cells and primary tumors, suggesting an important role for TCF4/beta-catenin in regulating GLCE expression both in vitro and in vivo.
22782288 Dietary fibre intake may modify the association between TCF7L2 rs7903146 and incidence of type 2 diabetes. Higher fibre intake may associate with protection from type 2 diabetes only among non-risk allele carriers.
22768190 The specific TCF-4J isoform, which lacks a regulatory SxxSS motif, has robust tumor-initiating potential under hypoxic conditions.
22766303 Both Sox9 and KLF4 interact with beta-catenin in an immunoprecipitation assay and reduce its binding to TCF4.
22712642 Older cardiovascular disease patients with the TCF7L2 TT genotype performed worse on tests of attention/executive/ psychomotor speed than CC and CT genotype carriers.
22699938 Kindlin 2 forms a tripartite complex with beta-catenin and TCF4.
22674979 TCF-4, beta-catenin, and SMAR1 tether at the -143-nucleotide site on the HIV LTR to inhibit HIV promoter activity.
22591707 The TCF7L2 rs7903146 and FTO rs8050136 polymorphisms, and particularly a weighted risk score of T2 diabetes risk alleles, predict diabetes after gestational diabetes mellitus.
22583123 TCF7L2 and ADIPOQ together might play an important role in explaining these traits and to understand the biological and genetic mechanisms underlying T2D, and the role of other T2D genes must also be evaluated with these continuous traits
22558147 The type 2 diabetes susceptible genotype of TCF7L2 was associated with a lower risk of islet autoantibodies and progression to type 1 diabetes.
22552033 TCF7L2 HapA attenuates the positive association between animal protein intake and long-term body weight change in middle-aged Europeans but does not interact with the GI of the diet.
22524208 TCF7L2rs12255372 variant (T/T) is associated with increased risk of gestational diabetes mellitus in Caucasian women.
22487833 The associations between SNPs of TCF7L2, CDKAL1, SLC30A8 and HHEX and the development of DR and DN.
22480428 Report association of TCF7L2 haplotypes with type 2 diabetes and gestational diabetes.
22443257 None of the 12 SNPs in the six genes (KCNJ11, TCF7L2, SLC30A8, HHEX, FTO and CDKAL1) uncovered in the genome-wide association studies were associated with polycystic ovary syndrome.
22441719 genetic association studies in population in Latvia: Data suggest that 3 SNP in TCF7L2 (rs7901695; rs7903146; rs12255372; not rs11196205) are associated with susceptibility to type 2 diabetes in nonobese subjects in this population.
22402060 rs4132670 is a non-tissue-specific candidate functional single nucleotide polymorphism that has the potential to play a role in TCF7L2 gene expression and type 2 diabetes risk.
22355027 Dietary fiber intake modulates the association between variants in TCF7L2 and weight loss during a lifestyle intervention.
22318732 MUC1-C oncoprotein contributes to TCF7L2 activation and thereby promotes cyclin D1 expression in breast cancer cells.
22301903 Genetic variants associated with the reproductive phenotype have been mapped to the fibrillin-3 (FBN3) gene and to a novel transcription factor-7-like 2 (TCF7L2) locus (rs11196236 G).
22296403 genetic association studies in a population in China: Data suggest that an SNP in TCF7L2 (rs290487) is associated with metabolic defects in subjects with polycystic ovary syndrome; carriers of the C allele of rs290487 exhibit insulin resistance.
22275441 Analyses indicate that T2D genetic risk is primarily mediated through the effect of TCF7L2 in African Americans.
22258766 SPINDLIN1, which may be a novel substrate of the Aurora-A kinase, promotes cancer cell growth through WNT/TCF-4 signaling activation.
22247771 Single nucleotide polymorphism in TCF7L2 is associated with schizophrenia.
22245614 TCF7L2 may be an important susceptibility gene for type 2 diabetes mellitus in some Chinese populations
22232078 These findings demonstrate that transcription factor TCF4 plays an important role in determining or maintaining the phenotype and functional properties of human corneal epithelial stem cells.
22231735 Sox4 may serve as a positive regulator of beta-catenin signaling through alteration in TCF4 expression during morular differentiation of endometrial carcinoma cells, leading to inhibition of cell proliferation.
22156527 Knockdown of either beta-catenin or TCF-4 induced LTR activity in astrocytes.
22156527 Knockdown of Beta-catenin (CTNNB1) and transcription factor 4 (TCF4) by siRNA enhances HIV-1 transcription in astrocytes
22136959 Genotype of the TCF7L2 rs12255372 gene was associated with lower fasting plasma glucose (p = 0.001) and lower homeostasis model assessment of insulin resistance (HOMA-R; p = 0.001) in nonobese children
22109522 Data show that beta-catenin/BCL9-Like (BCL9L)/T-cell factor 4 (TCF4) signalling directly targets the GCM1/syncytin pathway and thereby regulates the fusion of human choriocarcinoma cells.
22109281 An SNP in TCF7L2 (rs7903146) is associated with autoimmune diabetes and type 2 diabetes in European dataset and Hungarian dataset; this SNP was not associated with type 1 diabetes. [META-ANALYSIS; CASE-CONTROL STUDY]
22022540 FasL (TCF/LEF1) binding elements formed complexes with the TCF-4 and beta-catenin transcription factors in vitro and in vivo.
22016394 Tumor-suppressive effects of psoriasin (S100A7) are mediated through the beta-catenin/T cell factor 4 protein pathway in estrogen receptor-positive breast cancer cells.
21983179 results indicate a novel mechanism through which the Wnt transcription factor TCF4 mediates chemoradioresistance. Moreover, they suggest that TCF4 is a promising molecular target to sensitize resistant tumor cells to (chemo-) radiotherapy
21956205 we provide new insight into how TCF4L2 affects miRNA expression, and how these changes in miRNA expression may influence cancer progression.
21921652 The odds ratios for stroke/TIA were...0.99 (95%CI 0.78-1.25) for rs7903146/TCF7L2. Further exploration revealed that male patients with the T allele of rs7903146/TCF7L2 had a worse clinical outcome compared with male patients carrying the C allele.
21913056 A novel polyadenylation signal within TCF7L2 identified that can result in the production of isoforms that act to repress TCF/LEF-dependent target genes.
21892161 We found a colorectal carcinoma cell line harboring the fusion gene to be dependent on VTI1A-TCF7L2 for anchorage-independent growth using RNA interference-mediated knockdown.
21857094 evaluation of TCF7L2 polymorphisms in posttransplant diabetes mellitus(PTDM)in kidney transplant patients treated with tacrolimus;in late-onset PTDM, frequency of rs7903146 TT genotype and T minor allele were significantly increased compared to controls
21855162 Brief Report: after adjusting for body mass index fat/placental TCF7L2 expression was not significantly altered in gestational diabetes.
21814547 TCF7L2 polymorphism was associated with higher fasting proinsulin at baseline, higher baseline proinsulin:insulin ratio and increased proinsulin:insulin ratio in type 2 diabetes.
21772333 Results suggest that Tcf-4 can act as a repressor or activator of breast cancer progression by regulating OPN (osteopontin) expression in a Wnt-dependent manner.
21764279 Capsaicin treatment suppressed TCF-4 expression and disrupted the interaction of TCF-4 and beta-catenin in human colorectal cancer cells.
21720709 Tcf-4 binds to the potential binding sites in the gene promoter of AKT1.
21707949 TCF7L2 allelic variations are associated with gastric function, satiation, and GLP-1 levels
21678030 These results support the recent findings that rs7903146 of TCF7L2 gene is an important genetic risk factor for the development of type 2 diabetes in multiple ethnic groups.
21673050 Tcf7l2 plays a role in regulating glucose tolerance, suggesting that overexpression of this gene is associated with increased risk of T2D.
21641671 Results confirm association of rs7903146 in the TCF7L2 gene with increased risk of type 2 diabetes. The T allele is strongly associated with nephropathy, especially in early onset of diabetes.d
21636708 High TCF4 is associated with glioma progression.
21599871 Melanoma cell phenotype switching behaviour is regulated by differential LEF1/TCF4 activity.
21595284 Several studies have shown that decreased TCF7L2 protein inhibits the insulin secretory response to oral glucose through impaired incretin action(GLP-1, GIP).
21543200 TCF7L2 rs7903146 polymorphism influences MetS risk, which is augmented by both gender and dietary dietary saturated fat intake.
21510814 The highest risk of T2DM was 3.1, obtained by the genotype combination of the three associated SNPs
21454679 ZIPK may serve as a transcriptional regulator of canonical Wnt/beta-catenin signaling through interaction with NLK/TCF4.
21436631 The study suggests a connection between CD133 and EGR1 and emphasizes the importance of the EGR1/TCF4/CD133/LGR5 network in colorectal cancer.
21423583 These results suggest that TCF7L2 variants rs7903146 rs12255372, and rs11196205 are significantly associated with angiographically diagnosed coronary artery disease, specifically in patients with type 2 diabetes.
21414605 The association reported here with a well-known diabetes variant suggests that the observed comorbidity is partially caused by genetic risk variants.
21388956 Activation of the MAPK pathway by FGFR-3 is also required for the induction of Paneth cell markers in addition to and independent of the effect of FGFR-3 on TCF4/beta-catenin activity
21384500 Type 2 diabetic carriers of the TCF7L2 risk alleles in rs1225537 and rs7901346 had increased risk of type 2 diabetes and elevated HbA(1c)
21383188 T-cell factor 4 functions as a tumor suppressor whose disruption modulates colon cell proliferation and tumorigenesis.
21357677 function-specific transcripts of TCF7L2, which possessed distinct physiological and pathophysiological effects on the beta-cell. The presence of deleterious TCF7L2 splice variants may be a mechanism of beta-cell failure in T2DM.
21301999 Genetic variations in transcription factor 7-like 2 gene is associated with breast cancer.
21292023 role of beta-catenin/Tcf4/survivin signaling in determining the fate of human corneal epithelial stem cells in different media
21285352 HIPK2-dependent phosphorylation caused the dissociation of LEF1, TCF4, and TCF3 from a target promoter in vivo.
21256126 Data suggest that conserved splicing motifs may have a major influence on the transcriptional activity and functional properties of TCF-4 isoforms and alter the characteristics of the malignant phenotype.
21159844 TCF7L2 diabetes risk variants, either as single-nucleotide polymorphisms or as haplotypes, detrimentally influence beta-cell function
21150882 strong associations of two SNPs (rs7903146 and rs12255372) in TCF7L2 with FPG and HbA1c levels
21115178 SNP in the TCF7L2 gene are associated with differences in insulin secretion, blood pressure, blood lipids and coagulation in MetS patients, and may be modulated by saturated fatty acids in plasma or insulin resistance.
21109996 TCF7L2 variation is associated with an increased risk of early-onset type 2 diabetes among AA youth, and the association appears to be stronger in AA than NHW youth.
20980453 In African Americans, these observations suggest that rs7903146 is the trait-defining polymorphism of TCF7L2 associated with type 2 diabetes risk.
20980453 Observational study of gene-disease association. (HuGE Navigator)
20967696 Observational study of gene-disease association. (HuGE Navigator)
20957343 Middle-aged normoglycaemic individuals carrying the rs7903146 TCF7L2 risk TT genotype show early signs of dysregulated glucose metabolism, decreased processing of proinsulin and elevated GIP secretion following a meal challenge.
20957343 Observational study of gene-disease association. (HuGE Navigator)
20929593 Observational study of gene-disease association. (HuGE Navigator)
20923526 Meta-analysis and uncategorized study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20878273 It has become clear that TCF7L2 plays an important role for several vital functions in the pancreatic islet. In pancreatic islets four splice variants of TCF7L2 are predominantly expressed.
20873210 rs12255372 and rs13266634 markers are independent genetic type 2 diabetes risk factors in a Russian population.
20873210 Observational study of gene-disease association. (HuGE Navigator)
20849430 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20802253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20798759 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20739273 p15RS inhibits Wnt signaling by interrupting beta-catenin.TCF4 complex formation and that Wnt signaling initiates downstream gene expression by removing p15RS from promoters.
20712903 Observational study of gene-disease association. (HuGE Navigator)
20705583 Data show that NGX6 could suppress the translocation of beta-catenin from nucleus and cytoplasm to plasma membrane, inhibit the activity of TCF4 transcript factor, and down-regulate the expression of Wnt-direct-targeted genes.
20696899 Genome-wide analysis of DNA cis-regulatory regions bound by the intestine-restricted factor CDX2 in colonic cells uncovered highly significant overrepresentation of sequences that bind TCF4, a transcriptional effector of intestinal Wnt signaling.
20682688 Maternal TCF7L2 variants are associated with glucose levels carry an increased risk of adverse pregnancy outcome in women without overt diabetes.
20682688 Observational study of gene-disease association. (HuGE Navigator)
20654575 these data reveal a lithium-induced RNA switch favoring the expression of TCF7L2-short forms, which results in a transcriptional de-repression of lithium target genes negatively regulated by TCF7L2-long forms.
20648057 TT genotype of rs12255372 and rs7903146 TCF7L2 gene variants is associated with lower insulin secretion and higher cardiosympathetic activity.
20648057 Observational study of gene-disease association. (HuGE Navigator)
20640398 Findings suggest that TCF7L2 is a central node in the regulation of human diabetes and other disease-associated genes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616309 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20597906 Observational study of gene-disease association. (HuGE Navigator)
20578204 Our study replicates the association between rs7903146 and IFG risk in a population-based, longitudinal cohort of Caucasians but not in African Americans.
20578204 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20550665 Observational study of gene-disease association. (HuGE Navigator)
20546291 TCF7L2 common genetic variants of susceptibility are associated only with low GADA antibody titre in LADA patients.
20546291 Observational study of gene-disease association. (HuGE Navigator)
20540670 rs7903146 C/T polymorphism associated with gestational diabetes in Greek women
20540670 Observational study of gene-disease association. (HuGE Navigator)
20532534 No difference in nuclear beta-catenin signal intensity was found, which may be caused by an alteration in Wnt pathway in microsatellite stable sporadic tumors by unknown mechanisms leading to lower TCF-3, 4 protein expression.
20508220 TCF7L2 variant affects risk for diabetes by modification of the insulinotropic effect of the incretin hormones may be true, but, the impaired incretin effect might simply be secondary to impaired glucose intolerance.
20503258 Variants located within the gene TCF7L2 are strongly associated with Type-2 diabetes but not with Metabolic Syndrome.
20503258 Observational study of gene-disease association. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20485196 Observational study of gene-disease association. (HuGE Navigator)
20478041 Observational study of gene-disease association. (HuGE Navigator)
20459822 A minimal promoter for intestinal cell kinase contains functional sites for beta-catenin/TCF7L2 and FOXA.
20437825 Observational study of gene-disease association. (HuGE Navigator)
20424228 Observational study of gene-disease association. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20372961 beta-catenin/TCF4 transactivates miR-30e during intestinal cell differentiation.
20361036 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20299486 The T-allele of TCF7L2 rs7903146 polymorphism was independently associated with increasing fasting glucose values toward hyperglycemia in the follow-up.
20299486 Observational study of gene-disease association. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20161779 Studies identified significant association between variants in CDKN2A/B, CDKAL1 and TCF7L2, and type 2 diabetes in a Han Chinese cohort, indicating these genes as strong candidates conferring susceptibility to type 2 diabetes across different ethnicities.
20161779 Observational study of gene-disease association. (HuGE Navigator)
20142250 The TCF7L2 rs7903146 T allele was inversely associated with prostate cancer using a dominant genetic model
20122174 Axin downregulates TCF-4 transcription via beta-catenin and independently of p53.
20118932 rs7903146, a TCF7L2 intronic variant strongly associated with type 2 diabetes, is located in islet-selective open chromatin.
20107109 Reduced paracrine glucagon stimulation may contribute to the impairment of beta-cell function in the carriers TCF7L2 T-allele associated with increased risk of type 2 diabetes.
20107109 Observational study of gene-disease association. (HuGE Navigator)
20097709 Intronic TCF7L2 variants may regulate alternative transcript isoforms, which in turn may have distinct physiologic roles.
20095040 RT-PCR analysis of TCF7L2 mRNA levels in tumor samples revealed significantly lower levels in patients with metastasis when compared with those without metastasis.
20092643 Observational study of gene-disease association. (HuGE Navigator)
20081857 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20075150 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
20054294 Chinese patients with the C allele of TCF7L2rs290487(C/T) had higher total cholesterol levels and lower body mass index and heightened risk of developing type 2 diabetes mellitus.
20054294 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20043145 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20041287 There was no association of the genetic polymorhism rs7903146 of TCF7L2 with the occurrence of polycystic ovary syndrome in the Chinese population.
20041287 Observational study of gene-disease association. (HuGE Navigator)
20033802 Significant correlation between expression of a unique splicing form of TCF7L2 suggests that transcripts may share neuroendocrine functions important for brain, gut and pancreatic islets.
20032493 Individuals who are homozygous for the TCF7L2 rs7903146 T-risk allele are more senstive to low fat than to high fat weight-loss diets.
20032493 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20028944 diabetes-associated alleles of TCF7L2 are associated with less weight loss in response to lifestyle intervention
20028944 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20027603 Enhanced expression of TCF4 is associated with ulcerative colitis-associated neoplasia.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19934000 TCF7L2 genotype does not significantly affect overall insulin sensitivity.
19934000 Observational study of gene-disease association. (HuGE Navigator)
19933996 Observational study of gene-disease association. (HuGE Navigator)
19924301 analysis of control of TCF-4 expression by VDR and vitamin D in the mouse mammary gland and colorectal cancer cell lines
19924244 rs7903146 T allele of TCF7L2 is associated with diabetes and, in non-diabetic individuals, with a higher prevalence and severity of coronary artery disease and cardiovascular events
19924244 Observational study and clinical trial of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895682 These findings suggest that some splicing forms of TCF7L2 may be functionally important for regulation of MYC expression in colon tissue but this regulation is not directly dependent on rs6983267.
19895682 Observational study of gene-disease association. (HuGE Navigator)
19885641 The rs7903146 variant of TCF7L2 significantly increased type 2 diabetes mellitus risk in the Palestinian population.
19876004 Observational study of gene-disease association. (HuGE Navigator)
19864407 Subjects with the unfavorable TT genotype of TCF7L2 showed higher values of fasting glucose and lower homeostasis model assessment of beta cell function at baseline.
19864407 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19833889 Observational study of gene-disease association. (HuGE Navigator)
19825152 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19808892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19806338 Genetic variants in exon 4 of TCF7l2 were associated with impaired insulin secretion and incident diabetes and variants near 3' end were associated with insulin resistance in a Chinese cohort.
19794065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19789636 alternatively spliced TCF7L2 may have different functional roles in omental and subcutaneous adipose tissue but is not associated with SNPs rs7903146 and rs12255372 or T2D status
19778269 Expression of TCF-4 in human astrocytic cells decreased HIV-1 Tat-mediated transcription of the HIV-1 LTR, while GST pull-down assays revealed a direct interaction of Tat with TCF-4, suggesting TCF-4 may regulate the level of HIV-1 gene transcription
19760027 Observational study of gene-disease association. (HuGE Navigator)
19741467 Observational study of gene-disease association. (HuGE Navigator)
19734900 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19732438 TCF7L2 variant is not associated with risk of breast or ovarian cancer.
19732438 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19718565 Single nucleotide polymorpisms, in TCF7L2 hanve no association with polycystic ovary syndrome or related clinical features in Chinese Women.
19718565 Observational study of gene-disease association. (HuGE Navigator)
19713311 our data show that the TCF7L2 rs7903146 polymorphism, a known risk factor for type 2 diabetes in the general population, also associates with NODAT
19679347 Beta-catenin and TCF4 activate the human StarD7 gene interacting with its promoter region through Wnt/beta-catenin signalling.
19643578 This study concluded TCF7L2, a risk factor for type 2 diabetes in the general population, is also a risk factor for type 2 diabetes in African-American patients with SCZ or schizoaffective disorder.
19643578 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19636253 Data show that predicted risks were below average for carriers of the TCF7L2 CC genotype and above average for the CT and TT genotypes.
19636253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19615048 We found no evidence for an association between TCF7L2 genotype and fetal and early postnatal growth. Furthermore, this TCF7L2 polymorphism was not associated with an increased risk of small-for-gestational-age
19615048 Observational study of gene-disease association. (HuGE Navigator)
19602701 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
19602480 Alternative splicing of TCF7L2 is Tissue-specific.
19592620 Observational study of gene-disease association. (HuGE Navigator)
19585101 In cystic fibrosis patients not treated with systemic glucocorticoids, the effect of TCF7L2 single nucleotide polymophrism is even greater in predicting risk of type 2 diabetes.
19585101 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19573884 No significant associations were seen between tcfl2 polymorphism and insulin sensitivity
19563778 Daxx functions as a positive coregulator in modulating the beta-catenin/TCF4-dependent transcriptional potential via TCF4 interaction.
19533015 Frequency of the TT genotype of TCF7L2 polymorphsim is greater in latent autoimmune diabetic adults compared with normal controls.
19533015 Observational study of gene-disease association. (HuGE Navigator)
19509102 role for type 2 diabetes (T2D) risk-conferring gene TCF7L2 in insulin resistance in both Taiwanese and Caucasian youth.
19509102 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19506043 epistatic effects of five candidate genes, including ADIPOQ, ENPP1, GHSR, PPAR and TCF7L2, are significantly associated with the risk of DN amongst Taiwanese T2D individuals.
19506043 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19497595 The risk allele at TCF7L2 rs7903146 may have a role in the pathogenesis of premature adrenarche in lean subjects.
19497595 Observational study of gene-disease association. (HuGE Navigator)
19482368 Single nucleotide polymorphisms are strongly associated with the risk of type 2 diabetes in an East Asian population.
19482368 Meta-analysis of gene-disease association. (HuGE Navigator)
19473183 The TCF7L2 rs7903146 polymorphism is not associated with the change in insulin secretion during GH treatment in short SGA children.
19473183 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19443654 Study provides the first evidence for the involvement of MAD2B in TCF4-mediated epithelial-mesenchymal transdifferentiation.
19401414 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19386626 Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GLP-1R and GIP-R.
19380854 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19368707 In the Tunisian population, TCF7L2-rs7903146 T allele confers an increased risk of developing type 2 diabetes
19368707 Observational study of gene-disease association. (HuGE Navigator)
19351735 Evidence of association with two independent TCF7L2 loci in a PCOS and glucose intolerant cohort.
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19288077 Elevated hepatic glucose production and reduced insulinotropic effect of incretin hormones contribute to an increased risk of type 2 diabetes in carriers of the rs7903146 risk T allele of TCF7L2
19288077 Observational study of gene-disease association. (HuGE Navigator)
19286335 TCF7L2 is not a risk factor for obesity in Tunisians, but its effect on type II diabetes risk is modulated by obesity. The TCF7L2 rs7903146 T allele is associated with T2D susceptibility in nonobese individuals from Tunisia.
19286335 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19279076 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19269971 AP-1 and TCF-4 binding sites are the main regulatory regions directing versican production provide new insights into versican promoter regulation during melanoma progression.
19267370 Observational study of gene-disease association. (HuGE Navigator)
19258437 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19258404 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19252133 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19247628 No significant difference in overall amount or splicing pattern is observed between carriers and non-carriers of the type 2 diabetes risk allele.
19247372 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19228405 Meta-analysis of gene-disease association. (HuGE Navigator)
19228405 This meta-analysis demonstrates that four variants of TCF7L2 gene are all associated with type 2 diabetes mellitus, and indicates a multiplicative genetic model for all the four polymorphisms [review]
19225753 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19221600 The genetic association of TCF-4 with ileal Ctohn's disease provides evidence that the decrease in Paneth cell alpha-defensins is a primary factor in disease pathogenesis.
19221600 Observational study of gene-disease association. (HuGE Navigator)
19211816 Carbohydrate quality and quantity modified risk of T2D associated with TCF7L2, which suggests that changes in risk attributable to the TCF7L2 variant are magnified under conditions of increased insulin demand
19211816 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19183934 No association with TCF7L2 variations and adiposity, but bias may have occurred by the evaluation of obesity in separate groups of glycaemic cases and controls
19183934 Observational study of gene-disease association. (HuGE Navigator)
19172244 Observational study of gene-disease association. (HuGE Navigator)
19169495 Observational study of genetic testing. (HuGE Navigator)
19168596 When transfected into rat or mouse beta cells, is involved in maintaining expression of beta-cell genes regulating secretory function.
19156536 TCF7L2 gene expression was determined using quantitative real-time RT-PCR. Treatment with curcumin significantly increased TCF7L2 gene expression while treatment with LPS decreased TCF7L2 gene expression.
19149908 the inverse association between whole-grain consumption and type 2 diabetes risk might depend on variation in TCF7L2.
19149908 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141698 High polyunsaturated fatty acid intakes were associated with atherogenic dyslipidemia in carriers of the minor T allele at the TCF7L2 single nucleotide polymorphism.
19141698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141695 Observational study of gene-disease association. (HuGE Navigator)
19139842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19131553 TCF4 regulates BIRC5 gene expression
19124064 BCL-W may function as a downstream effector of inappropriate WNT/beta-catenin signalling.
19105201 TCF7L2 CT/TT genotype is more frequent in nonalcoholic fatty liver disease and predicts the presence and severity of liver disease.
19105201 Observational study of gene-disease association. (HuGE Navigator)
19082521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19057525 Genes implied in human type 2 diabetes development, TCF7L2, WFS1, FTO, SLC30A8, and GCKR, were mapped on Sus scrofa chromosomes 14, 8, 6, 4, and 3, respectively. Only TCF7L2 was significantly associated with five fat traits in pigs.
19056611 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19055834 TCF7L2 rs7903146 T allele is associated with a 1.57 increased risk for type 2 diabetes in a Brazilian cohort of patients with known coronary heart disease
19055834 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19053027 Located on chromosome 10 and suscptibility of polymorphisms are related to type 2 diabetes.
19053027 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19050058 TCF7L2 type 2 diabetes susceptibility alleles are associated with islet autoantibody-negative but not autoantibody-positive new onset diabetes in young patients.
19050058 Observational study of gene-disease association. (HuGE Navigator)
19033397 Type 2 diabetes susceptibility of TCF7L2 was confirmed in Japanese.
19033397 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19020324 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19012045 Common coding variant in the TCF7L2 gene is associated with type 2 diabetes.
19012045 Observational study of gene-disease association. (HuGE Navigator)
19002430 Observational study of gene-disease association. (HuGE Navigator)
18996470 An assay using unlabeled probes and the LightCycler or Rotor-Gene instruments was developed for genotyping of PPARG, PPARGC1A and transcription factor 7-like 2 (TCF7L2) polymorphisms.
18996470 Observational study of genetic testing. (HuGE Navigator)
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18992165 Increased expression in colorectal adenomas than in the adjacent normal epithelia
18984664 Observational study of gene-disease association. (HuGE Navigator)
18972257 Risk alleles of the TCF7L2 gene showed increased risk of diabetes even when controlled for traditional diabetes risk factors
18972257 Observational study of gene-disease association. (HuGE Navigator)
18958766 The rs7903146 variant of the TCF7L2 gene might influence PCOS predisposition, while no association is observed between the E23K variant of KCNJ11 and susceptibility to PCOS and related traits.
18958766 Observational study of gene-disease association. (HuGE Navigator)
18931037 Sudy provides the first significant evidence of association between the TCF7L2 rs7903146 polymorphism and type 2 diabetes risk in a large African American population.
18931037 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18853134 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18839133 Common variants in the TCF7L2 gene help to differentiate young but not middle-aged glutamic acid decarboxylase antibodies(GADA)-positive and GADA-negative diabetic patients
18839133 Observational study of gene-disease association. (HuGE Navigator)
18823720 Observational study of gene-disease association. (HuGE Navigator)
18806947 In morbidly obese nondiabetic patients, there was a positive correlation between TCF7L2 expression and BMI (R(2)=0.21).
18799618 Snail and Slug promote formation of beta-catenin-T-cell factor (TCF)-4 transcription complexes that bind to the promoter of the TGF-beta3 gene to increase its transcription
18762805 Results found a negative allele-dosage effect of the T allele of rs7903146 in the TCF7L2 gene on the changes in the HOMA-IR, the insulin sensitivity check index QUICKI and insulin secretion index HOMA-B% during a lifestyle intervention.
18762805 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18755497 Frameshift mutations of Wnt pathway genes AXIN2 and TCF4 in gastric carcinomas with high microsatellite instability are reported.
18719881 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18712344 Evidence that the TCF7L2 gene is a major determinant of type 2 diabetes risk in Spain, as in other southern Eutopean populations.
18712344 Observational study of gene-disease association. (HuGE Navigator)
18706099 co-existence of TCF7L2 variants and the SPINK1 and CTSB mutations, that predict susceptibility to exocrine damage, may interact to determine the onset of diabetes in TCP patients
18706099 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18702948 TCF7L2 mRNA expression is fat-depot specific but does not seem to provide the mechanistic link explaining genetic association with type 2 diabetes mellitus.
18694974 Study show that polymorphisms in TCF7L2 were associated with type 2 diabetes risk in the studied population.
18689695 Observational study of gene-disease association. (HuGE Navigator)
18655717 Our study is consistent with weak or no association of type 2 diabetes in Arabs with the two TCF7L2 variants
18650481 variants in the TCF7L2 gene are associated with reduced kidney function and CKD progression
18621708 the presumed cancer-promoting gene TCF7L2 functions instead as a transcriptional repressor that restricts colorectal cancer (CRC) cell growth.
18611970 The primary defect of rs7903146 T-allele carriers is impairment of insulin secretion rather than a defect in insulin action in peripheral tissues.
18611970 Observational study of gene-disease association. (HuGE Navigator)
18599616 Summarize recent findings demonstrating the association between TCF7L2 polymorphisms and the risk of type 2 diabetes, outline experimental evidence of the potential function of TCF7L2 in pancreatic and intestinal endocrine cells. Review.
18598350 TCF7L2 SNPs revealed a significant association with type 2 diabetes
18598350 Observational study of gene-disease association. (HuGE Navigator)
18597214 Gene variants of CDKAL1, PPARG, IGF2BP2, HHEX, TCF7L2, and FTO predispose to type 2 diabetes in the German KORA 500 K study population.
18597214 Observational study of gene-disease association. (HuGE Navigator)
18591388 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18555673 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18546086 The higher homeostasis model assessment insulin resistance index (HOMA-B%) index in TT-homozygotes indicates TCF7L2 to be a susceptibility gene for the development of impaired glucose tolerance in obese children.
18546086 Observational study of gene-disease association. (HuGE Navigator)
18541996 genetic variants in TCF7L2 confer a strong risk of future type 2 diabetes possibly mediated by altering expression of TCF7L2 in pancreatic islets [review]
18519685 results indicate that Tcf-4 maintains low levels of claudin-7 at the bottom of colonic crypts, acting via Sox-9
18516622 Observational study of gene-disease association. (HuGE Navigator)
18498634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18493736 we did not find any mutation in the coding sequence of TCF7L2 that confers a genetic risk for type 2 diabetes in a Chinese population
18493736 Observational study of gene-disease association. (HuGE Navigator)
18478343 there was suggestive evidence for an inverse association associated of colorectal cancer and ademoma with homozygosity for the minor allele of RS12255372 (TCF7L2 TT) and conditional and covariate adjusted risk 0for heterogeneity for in women and men
18478343 Observational study of gene-disease association. (HuGE Navigator)
18469204 Data confirmed the associations of single nucleotide polymorphisms in TCF7L2 with risk for type 2 diabetes in Asians.
18469204 Observational study of gene-disease association. (HuGE Navigator)
18461161 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18445358 association of TCF7L2 with type 2 diabetes [review]
18443202 Data show that one TCF7L2 SNP (rs7903146) showed compelling evidence of association with type 2 diabetes in African Americans.
18443202 Observational study of gene-disease association. (HuGE Navigator)
18439914 Determination of role nuclear pore complex in regulating TCF4/beta cateninin mediated Wnt signaling.
18437354 Increased health risk associated with an rs7903146 genotype is specific to mortality in diabetes and diabetic angiopathies.
18437354 Observational study of gene-disease association. (HuGE Navigator)
18398040 These data suggest that colon cancer risk associated with the rs7903146 TCF7L2 polymorphism is modified by use of aspirin/NSAIDs
18398040 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18397358 TCF7L2 gene is a major risk factor for development of T2DM in Khatri Sikhs from North India.
18397358 Observational study of gene-disease association. (HuGE Navigator)
18347071 We confirm that c-Jun functions in canonical Wnt signaling and show that c-Jun functions as a scaffold in the beta-catenin-TCFs transcription complex bridging Dvl to TCF.
18342627 TCF7L2 mRNA levels in adipocytes are decreased by insulin and seem to increase in insulin resistant subjects and in HapA carriers.
18310307 Observational study of gene-disease association. (HuGE Navigator)
18302196 The TCF7L2 gene may alter risk of developing more aggressive prostate cancer.
18302196 Observational study of gene-disease association. (HuGE Navigator)
18291022 TCF7L2 is an important genetic risk factor for the development of type 2 diabetes in multiple ethnic groups
18291022 Observational study of gene-disease association. (HuGE Navigator)
18288125 TCF7L2 rs7903146 T allele is present in obese hypertensive patients as much as in the general population.
18288125 Observational study of gene-disease association. (HuGE Navigator)
18282631 TCF7L2 variants are associated with increased risk for diabetes mellitus in Emirati subjects.
18282631 Observational study of gene-disease association. (HuGE Navigator)
18268068 Subjects who were initially cancer-free and carrying certain genetic variants of TCF7L2 have an increased risk of colon cancer.
18268068 Observational study of gene-disease association. (HuGE Navigator)
18268006 TCF4-binding regions significantly correlate with Wnt-responsive gene expression profiles derived from primary human adenomas
18264689 Diabetes-associated variants in TCF7L2 and CDKAL1 impair insulin secretion and conversion of proinsulin to insulin.
18264689 Observational study of gene-disease association. (HuGE Navigator)
18248681 Observational study of genotype prevalence. (HuGE Navigator)
18239663 TCF7L2 is not a risk factor for obesity in European populations, but its effect on type 2 diabetes risk is modulated by obesity.
18239663 Observational study of gene-disease association. (HuGE Navigator)
18203713 myostatin enhanced nuclear translocation of beta-catenin and formation of the Smad3-beta-catenin-TCF4 complex, together with the altered expression of a number of Wnt/beta-catenin pathway genes in hMSCs
18166673 A precise and reproducible electrophoretic technique is used to make an allelic assignment from genomic DNA of the polymorphism in microsatellite DG10S478 of TCF7L2.
18097733 Single nucleotide polymorphisms in TCF7L2 were associated with type 2 diabetes
18072015 DG10S478 variant seems to have no influence on manifestation of diabetes and the development of microvascular complications.
18072015 Observational study of gene-disease association. (HuGE Navigator)
18071026 The role of TCF7L2 in beta-cell function and survival in cultured cells is reported.
18048388 Ectopic expression of Dkk3 in lung cancer cells with Dkk3 hypermethylation induced apoptosis and inhibited TCF-4 activity
18039847 MTG family members associate specifically with TCF4. Coexpression of beta-catenin disrupted the association between these corepressors and TCF4.
17983804 Topo IIalpha interacts with beta-catenin/T-cell factor-4 as a novel transcriptional co-activator in colorectal neoplasms.
17977958 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17972059 TCF7L2 is associated with high serum triacylglycerol and differentially expressed in adipose tissue in families with familial combined hyperlipidaemia
17971425 Observational study of gene-disease association. (HuGE Navigator)
17971425 TCF7L2 variants could play a role in the pathogenesis of type 2 diabetes mellitus in the Hispanic American population through a mchanism involving insulin secretion.
17934151 Observational study of gene-disease association. (HuGE Navigator)
17934151 TCF7L2 rs7903146 genetic variation is associated with an increased risk of post transplantation diabetets mellitus in renal allograft recipients.
17909099 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17909099 Variation within TCF7L2 does not confer major risk for type 2 diabetes among the Pima Indian population.
17901222 TCF7L2 (transcription factor 7-like 2) has been identified as a gene for type 2 diabetes.
17875931 Data indicate that Sox4 and 17 can act as both antagonists and agonists of beta-catenin/TCF activity, and this mechanism may regulate Wnt signaling responses in many developmental and disease contexts.
17805508 Observational study of gene-disease association. (HuGE Navigator)
17805508 Establishing whether variation in TCF7L2 also influences the development of polycystic ovary syndrome and type 2 diabetes.
17768662 Overexpression of TCF-4 is associated with the development of lung cancer
17725629 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17725629 common variation in the TCF7L2 gene contributes to Type 2 diabetes risk in UK patients recruited in general practice, but the risk allele frequency may be lower than that in subjects enriched for genetic effects
17709525 A reduced expression in ileal Crohn's disease of the Wnt-signaling pathway transcription factor Tcf-4, a known regulator of Paneth cell differentiation and alpha-defensin expression, was reported.
17697858 Observational study of gene-disease association. (HuGE Navigator)
17697858 The rs12255372(G/T) and rs7903146(C/T) polymorphisms of TCF7L2 gene confer susceptibility to type 2 diabetes mellitus in Asian Indians.
17683561 Observational study of gene-disease association. (HuGE Navigator)
17683561 The genetic susceptibility from the TCF7L2 gene variation is a unique mechanism of type 2 diabetes (T2D), and is not shared by type 1 diabetes (T1D).
17683561 TCF7L2 does not participate in the etiology of Type 1 diabetes
17671651 Observational study of gene-disease association. (HuGE Navigator)
17671651 the increased risk of type 2 diabetes conferred by variants in TCF7L2 involves the enteroinsular axis, enhanced expression of the gene in islets, and impaired insulin secretion.
17668382 Genome-wide association study of gene-disease association. (HuGE Navigator)
17665514 Observational study of gene-disease association. (HuGE Navigator)
17665514 Common variants in the TCF7L2 gene and its predisposition to type 2 diabetes in UK European Whites, Indian Asians and Afro-Caribbean men and women are reported.
17661009 Variants of TCF7L2 specifically impair GLP-1-induced insulin secretion.
17659738 Novel mutations in exon 4 of hTCF-4 gene were revealed in this study, which might be of importance in the pathogenesis of sporadic rectal cancer patients with high frequency microsatellite instability.
17653210 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17618413 Observational study of gene-disease association. (HuGE Navigator)
17618413 Odds ratio for single nucleotide polymorphisms associated with plasma proinsulin, beta cell dysfunction and increased risk of type 2 diabettes.
17609304 Observational study of gene-disease association. (HuGE Navigator)
17609304 Variations at TCF7L2 contribute to Type 2 diabetes.
17601994 Observational study of gene-disease association. (HuGE Navigator)
17601994 Variations in the TCF7L2 gene significantly contribute to diabetes susceptibility in African-American populations.
17593304 Observational study of gene-disease association. (HuGE Navigator)
17593304 TCF7L2 rs7903146 variant neither increases the risk for SGA nor modulates birth weight and young adulthood glucose homeostasis in French Caucasian subjects born with SGA
17579832 Observational study of gene-disease association. (HuGE Navigator)
17579832 Results confirmed TCF7L2 as a risk factor in a population of European descent, where it reduced glucose tolerance and insulin sensitivity, but not insulin secretion.
17579206 Observational study of gene-disease association. (HuGE Navigator)
17579206 TCF7L2 genetic polymorphisms are major determinants for risk of type 2 diabetes in the Chinese population.
17563454 The discovery of TCF7L2 as a diabetes gene illustrates that novel true diabetes genes can be found, their association with type 2 diabetes replicated and their effect incorporated into risk prediction models (Review)
17540954 an increased risk of type 2 diabetes is associated with TCF7L2 rs7903146 genotype.
17519421 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17519421 TCF7L2 variants influence therapeutic response to sulfonylureas but not metformin
17503332 Observational study of gene-disease association. (HuGE Navigator)
17503332 Study assessed role of TCF4 in birth weight.
17476472 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17470138 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17470138 evaluated the association of the three TCF7L2 polymorphisms with NIDDM by using the program admixmap to fit a logistic regression model incorporating individual ancestry, sex, age, body mass index and education
17463248 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17437080 Observational study of gene-disease association. (HuGE Navigator)
17437080 A cariant of TCF7L2 is associated with incident type 2 diabetes in a separate population-based cross-sectional study.
17429603 Observational study of gene-disease association. (HuGE Navigator)
17429603 Variants of TCF7L2 may be associated with increased disease severity and therapeutic failure in diabetes.
17416797 Observational study of gene-disease association. (HuGE Navigator)
17416797 findings suggest that the TCF7L2 risk allele may predispose to type 2 diabetes by impairing beta-cell proinsulin processing
17392368 Transcription factor 4 (TCF-4), the downstream effector of Wnt signaling, is implicated in repressing HIV replication in astrocytes.
17351281 combined effect of obesity and genotype in predicting type 2 diabetes risk in a sample of French Canadian cardiac patients. in predicting type 2 diabetes risk in a sample of French Canadian cardiac patients.
17342473 Observational study of gene-disease association. (HuGE Navigator)
17342473 Variant is associated with an increased risk of gestational diabetes mellitus in Scandinavian women.
17340123 Observational study of gene-disease association. (HuGE Navigator)
17340123 May be a strong candidate for conferring susceptibility to type 2 diabetes across different ethnicities in Japan.
17317761 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17317761 Variation in TCF7L2 is associated with gestational diabetes and interacts with adiposity to alter insulin secretion in Mexican Americans.
17311858 Observational study of gene-disease association. (HuGE Navigator)
17293876 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17259383 Observational study of gene-disease association. (HuGE Navigator)
17259383 data provide evidence that variation in the TCF7L2 genomic region may affect risk for type 2 diabetes in Mexican Americans, but the attributable risk may be lower than in Caucasian populations
17245589 Observational study of gene-disease association. (HuGE Navigator)
17245589 TCF7L2 is a common susceptibility gene for type 2 diabetes in the Japanese population
17245407 Observational study of gene-disease association. (HuGE Navigator)
17245407 Several single nucleotide polymorphisms are associated with type 2 diabetes.
17226113 Observational study of gene-disease association. (HuGE Navigator)
17226113 TCF7L2 variants increase type 2 diabetes risk and may affect pancreatic beta cell function.
17181866 Observational study of gene-disease association. (HuGE Navigator)
17181866 polymorphism is associated with lower insulin levels, smaller waist circumference, and lower risk lipid profiles in the general elderly population.
17143297 AXIN1, AXIN2 and TCF7L2 may have roles in development of colorectal carcinomas [review]
17130514 Observational study of gene-disease association. (HuGE Navigator)
17130514 TCF7L2 gene is an important factor regulating insulin secretion, which could explain its association with type 2 diabetes.
17109766 Observational study of gene-disease association. (HuGE Navigator)
17109766 results suggest a possible influence of TCF7L2 rs12255372 on the risk of familial breast cancer
17093941 Observational study of gene-disease association. (HuGE Navigator)
17093941 TCF7L2 is an important gene for determining susceptibility to type 2 diabetes mellitus and it transgresses the boundaries of ethnicity.
17093940 No major contribution of TCF7L2 sequence variants to maturity onset of diabetes of the young (MODY) or neonatal diabetes mellitus was found in this study in French white subjects.
17091236 A high mobility group box-containing TCF7L2 leads to diabetes risk.
17065361 Observational study of gene-disease association. (HuGE Navigator)
17065361 TCF7L2 T at-risk allele variation predicts hyperglycemia incidence in a general French population, possibly through a deleterious effect on insulin secretion.
17063324 Although TCF7L2 is a major gene in type 2 diabetes, there is no evidence for association between this gene and type 1 diabetes.
17052462 crystallographic analysis of how beta-catenin, BCL9, BCL9-2 and Tcf4 interact
17031610 Observational study of gene-disease association. (HuGE Navigator)
17031610 Variants of the TCF7L2 gene contribute to the risk of type 2 diabetes. The population-attributable risk from this factor in the Dutch type 2 diabetes population is 10%.
17020404 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17020404 Combining information from several known common risk polymorphisms allows the identification of population subgroups with markedly differing risks of developing type 2 diabetes compared to those obtained using single polymorphisms.
17003360 Observational study of gene-disease association. (HuGE Navigator)
17003360 These data provide evidence that TCF7L2 is a major determinant of type 2 diabetes risk in European populations and suggests that this transcription factor plays a key role in glucose homeostasis.
17003358 Observational study of gene-disease association. (HuGE Navigator)
17003358 These results suggest that TCF7L2 variants may act through insulin secretion to increase the risk of type 2 diabetes.
16936218 Observational study of gene-disease association. (HuGE Navigator)
16936218 These data provide replicating evidence that variants in TCF7L2 increase the risk for type 2 diabetes and novel evidence that the variants likely influence both insulin secretion and insulin sensitivity.
16936217 Observational study of gene-disease association. (HuGE Navigator)
16936216 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16936215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16855264 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16855264 Common variants (rs12255372 and rs7903146) in TCF7L2 seem to be associated with an increased risk of diabetes among persons with impaired glucose tolerance
16724116 evidence provided that HIC1 antagonizes the TCF/beta-catenin-mediated transcription in Wnt-stimulated cells; this appears to be due to the ability of HIC1 to associate with TCF-4 and to recruit TCF-4 and beta-catenin to the HIC1 bodies
16690926 findings suggest that activity at the HIV-1 promoter is influenced by phosphorylation of Sp1, which is affected by Tat and DNA-PK; interactions among TCF-4, Sp1 and/or Tat may determine the level of viral gene transcription in astrocytic cells
16690926 Expression of TCF-4 in human astrocytic cells decreased HIV-1 Tat-mediated transcription of the HIV-1 LTR, while GST pull-down assays revealed a direct interaction of Tat with TCF-4, suggesting TCF-4 may regulate the level of HIV-1 gene transcription
16569639 Daxx reduced DNA binding activity of Tcf4 and repressed Tcf4 transcriptional activity.
16547505 A role is suggested for TCF7L2 frameshift mutation during MSI-H colorectal tumor progression, by regulating the relative proportion of the different TCF7L2 isoforms.
16532032 Represses Wnt signaling in breast tissue, and its downregulation contributes to the activation of Wnt signaling.
16415884 Observational study of gene-disease association. (HuGE Navigator)
16415884 Suggestive linkage of type 2 diabetes mellitus to TCFL2 protein on chromosome 10q.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16311123 results suggest an established Wnt signaling pathway in most gastric cancers, a close correlation of beta-catenin/TCF4-mediated signaling with tumor dissemination, and the unlikelihood of a direct effect of activated Wnt signaling on CD44 expression
16291872 The positive inter-regulation between beta-cat/Tcf-4 signaling and ET-1 signaling potentiates proliferation and survival of prostate cancer (CaP) cells, thereby representing a novel mechanism that contributes to CaP progression.
16204248 TIS7, a negative regulator of transcriptional activity, represses expression of OPN and beta-catenin/Tcf-4 target genes
16007074 the phosphorylation-dependent interaction between c-Jun and TCF4 regulates intestinal tumorigenesis by integrating JNK and APC/beta-catenin, two distinct pathways activated by WNT signalling
15905022 characterization of the TCF4 with microsatellite instability (MSI) in colon cancer and leukemia cell lines; results delineate a novel role for MSI+TCF4 in leukemia and colon cancer progression
15853773 The regulation of GLCE expression by 2 cis-acting elements of the beta-catenin-TCF4 complex located in the enhancer region of the promoter are reported.
15806138 TCF4 expression mediated by beta-catenin/p300 may be important for initial steps during trans-differentiation of endometrial carcinoma cells.
15670774 Together, we suggest that quercetin is an excellent inhibitor of beta-catenin/Tcf signaling in SW480 cell lines, and the reduced beta-catenin/Tcf transcriptional activity is due to the decreased nuclear beta-catenin and Tcf-4 proteins.
15591320 identify selective beta-catenin binding hot spots of Tcf4, E-cadherin, and APC
15514942 TCF4-binding element was identified in PTTG promoter region in eesophageal squamous cell sscarscinomsa.
15040893 TCF4 could be an effective therapeutic target for suppressing the growth of hepatocellular cancers.
12861022 TCF-4N inhibits coactivation by beta-catenin of TCF/LEF transcription factors and potentiates the coactivation by beta-catenin of other transcription factors, such as SF-1 and C/EBPalpha
12799378 there is a direct interaction between the androgen receptor DNA binding domain (DBD) and Tcf4.
12446687 the C terminus of TCF4E cooperates with beta-catenin and p300 to form a specialized transcription factor complex that specifically supports the activation of the Cdx1 promoter
12408868 disruption of beta-catenin/TCF-4 activity in CRC cells induces a rapid G1 arrest and blocks a genetic program that is physiologically active in the proliferative compartment of colon crypts.
12378619 The high expression level of hTcf-4 in HCC, especially with metastasis, suggests that the over-expression of hTcf-4 gene may be closely associated with development and progression of HCC, but the mutation of this gene plays a less important role
12368361 role of TCF-4 upon transcription of the human immunodeficiency virus type 1 (HIV-1) promoter in human astrocytic cells
12368361 Expression of TCF-4 in human astrocytic cells decreased HIV-1 Tat-mediated transcription of the HIV-1 LTR, while GST pull-down assays revealed a direct interaction of Tat with TCF-4, suggesting TCF-4 may regulate the level of HIV-1 gene transcription
12086873 ITF-2, a downstream target of the Wnt/TCF pathway, is activated in human cancers with beta-catenin defects and promotes neoplastic transformation
11940574 Activation of AXIN2 expression by beta-catenin-T cell factor
11931652 Promoter characterization of the novel human matrix metalloproteinase-26 gene: regulation by the T-cell factor-4 implies specific expression of the gene in cancer cells of epithelial origin.
11713476 crystal structure of a human Tcf4-beta-catenin complex; comparison with recent structures of beta-catenin in complex with Xenopus Tcf3 (XTcf3) and mammalian E-cadherin
11713475 tcf4 can specifically recognize beta-catenin using alternative conformations

AA Sequence

MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPP      1 - 70
RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY     71 - 140
KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH    141 - 210
FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPY    211 - 280
PTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI    281 - 350
KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR    351 - 420
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYI    421 - 490
QGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEA    491 - 560
THKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE               561 - 619
//

Text Mined References (572)

PMID Year Title
27058589 2016 Transcription Factor 7-Like 2 (TCF7L2) rs7903146 Polymorphism as a Risk Factor for Gestational Diabetes Mellitus: A Meta-Analysis.
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26986145 2016 Association of the Transcription Factor 7 Like 2 (TCF7L2) Polymorphism With Diabetic Nephropathy Risk: A Meta-Analysis.
26934194 2016 Accumulating evidence for a role of TCF7L2 variants in bipolar disorder with elevated body mass index.
26914832 2016 Association between the rs7903146 Polymorphism in the TCF7L2 Gene and Parameters Derived with Continuous Glucose Monitoring in Individuals without Diabetes.
26681031 2015 Meta-analysis of the association between the rs7903146 polymorphism at the TCF7L2 locus and type 2 diabetes mellitus susceptibility.
26608632 2015 Association between the rs12255372 variant of the TCF7L2 gene and obesity in a Cameroonian population.
26604685 2015 Prevalence of the rs7903146C>T polymorphism in TCF7L2 gene for prediction of type 2 diabetes risk among Iranians of different ethnicities.
26576435 2015 The Protective Effect of Transcription Factor 7-Like 2 Risk Allele rs7903146 against Elevated Fasting Plasma Triglyceride in Type 2 Diabetes: A Meta-Analysis.
26536002 2015 Transcription Factor-7-Like 2 Gene Variants Affect the Metabolic Phenotypes of Polycystic Ovary Syndrome.
26525881 2016 TCF7L2 Genotype and ?-Cell Function in Humans Without Diabetes.
26393635 2015 Association of TCF7L2 Genetic Polymorphisms with Type 2 Diabetes Mellitus in the Uygur Population of China.
26367734 2015 Type 2 diabetes mellitus susceptibility gene TCF7L2 is strongly associated with hyperglycemia in the Saudi Arabia Population of the eastern province of Saudi Arabia.
26345943 2015 Association of TCF7L2 gene polymorphisms with susceptibility to type 2 diabetes mellitus in a Chinese Hui population.
26316572 2015 Association between transcription factor 7-like 2 rs7903146 polymorphism and diabetic retinopathy in type 2 diabetes mellitus: A meta-analysis.
26273662 2015 Association of the Genetic Polymorphisms in Transcription Factor 7-Like 2 and Peroxisome Proliferator-Activated Receptors- ? 2 with Type 2 Diabetes Mellitus and is Interaction with Obesity Status in Emirati Population.
26247673 2015 The association between the rs11196218A/G polymorphism of the TCF7L2 gene and type 2 diabetes in the Chinese Han population: a meta-analysis.
26109524 2015 Role of high-risk variants in the development of impaired glucose metabolism was modified by birth weight in Han Chinese.
26102344 2015 Polymorphisms in FTO and TCF7L2 genes of Euro-Brazilian women with gestational diabetes.
26058934 2015 Association of rs12255372 (TCF7L2) and D76N (PDX-1) Polymorphisms with Type 2 Diabetes in a Population Living in Northeast Iran.
26046964 2015 Glucose Metabolism in High-Risk Subjects for Type 2 Diabetes Carrying the rs7903146 TCF7L2 Gene Variant.
25946847 2014 [Frequency of some diseases and conditions in geriatric patients with coronary heart disease and various genotypes of transcription factor 7-like 2 protein].
25934528 2015 Polymorphism in the transcription factor 7-like 2 (TCF7L2) gene is associated with impaired proinsulin conversion--A meta-analysis.
25867435 2015 TCF7L2 gene polymorphisms and susceptibility to breast cancer: a meta-analysis.
25863010 2015 Association of LRP5, TCF7L2, and GCG variants and type 2 diabetes mellitus as well as fasting plasma glucose and lipid metabolism indexes.
25678841 2015 Genetic interaction analysis of TCF7L2 for biochemical recurrence after radical prostatectomy in localized prostate cancer.
25678248 2015 Association between rs7903146 and rs12255372 polymorphisms of transcription factor 7-like 2 gene and polycystic ovary syndrome: a systematic review and meta-analysis.
25627047 2014 The TCF7L2 rs7903146 (C/T) polymorphism is associated with risk to type 2 diabetes mellitus in Southern-Brazil.
25498973 2015 The type 2 diabetes associated rs7903146 T allele within TCF7L2 is significantly under-represented in Hereditary Multiple Exostoses: insights into pathogenesis.
25491720 2014 The TCF7L2 rs7903146 polymorphism, dietary intakes and type 2 diabetes risk in an Algerian population.
25483131 2014 T2DM GWAS in the Lebanese population confirms the role of TCF7L2 and CDKAL1 in disease susceptibility.
25398947 2015 Evidence of non-pancreatic beta cell-dependent roles of Tcf7l2 in the regulation of glucose metabolism in mice.
25353718 2015 rs7903146 polymorphism at transcription factor 7 like 2 gene is associated with total cholesterol and lipoprotein profile in HIV/hepatitis C virus-coinfected patients.
25299103 2014 Association of the rs7903146 and rs12255372 polymorphisms in the TCF7L2 gene with type 2 diabetes in a population from northeastern Brazil.
25274455 2015 The gene polymorphisms of UCP1 but not PPAR ? and TCF7L2 are associated with diabetic retinopathy in Chinese type 2 diabetes mellitus cases.
25224167 Weight loss independent association of TCF7 L2 gene polymorphism with fasting blood glucose after Roux-en-Y gastric bypass in type 2 diabetic patients.
25185853 2014 TCF7L2 rs7903146 polymorphism and diabetic nephropathy association is not independent of type 2 diabetes--a study in a south Indian population and meta-analysis.
25185411 2014 Association of rs7903146, rs12255372, and rs290487 polymorphisms in TCF7L2 gene with type 2 diabetes in an Iranian Kurdish ethnic group.
25131200 2014 A polymorphic enhancer near GREM1 influences bowel cancer risk through differential CDX2 and TCF7L2 binding.
25117344 2014 Transcription factor 7-like 2 polymorphisms and diabetic retinopathy: a systematic review.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
25058603 2014 Differential transcriptional and posttranslational transcription factor 7-like regulation among nondiabetic individuals and type 2 diabetic patients.
25048152 2014 A gene variant in the transcription factor 7-like 2 (TCF7L2) is associated with an increased risk of gestational diabetes mellitus.
25034524 2014 Oncogenicity of LHX4 in colorectal cancer through Wnt/?-catenin/TCF4 cascade.
25015099 2014 TCF7L2 is a master regulator of insulin production and processing.
25001176 2014 SOX10 is a novel oncogene in hepatocellular carcinoma through Wnt/?-catenin/TCF4 cascade.
24982424 2014 CREPT/RPRD1B, a recently identified novel protein highly expressed in tumors, enhances the ?-catenin·TCF4 transcriptional activity in response to Wnt signaling.
24961829 2014 TCF7L2 type 2 diabetes risk variant, lifestyle factors, and incidence of prostate cancer.
24925104 2014 Clinical and non-targeted metabolomic profiling of homozygous carriers of Transcription Factor 7-like 2 variant rs7903146.
24914535 2014 Differential methylation of TCF7L2 promoter in peripheral blood DNA in newly diagnosed, drug-naïve patients with type 2 diabetes.
24864085 2014 Is TCF7L2 variant associated with non-diabetic chronic kidney disease progression? Results of a family-based study.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24815492 2014 Genetic polymorphisms of TCF7L2 lack influence on risk of the polycystic ovary syndrome - a systemic analysis.
24667787 2015 Characterization of the transcriptional machinery bound across the widely presumed type 2 diabetes causal variant, rs7903146, within TCF7L2.
24639413 2014 Metabolic, hormonal characteristics and genetic variants of TCF7L2 associated with development of gestational diabetes mellitus in Mexican women.
24611738 2014 Relationships between TCF7L2 genetic polymorphisms and polycystic ovary syndrome risk: a meta-analysis.
24605829 2014 Wnt-dependent T-cell factor-4 controls human etravillous trophoblast motility.
24589551 2014 Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1.
24574000 2014 Transcription factor 7-like 2 (TCF7L2) gene polymorphism and clinical phenotype in end-stage renal disease patients.
24529562 2014 Transcription factor 7-like 2 (TCF7L2) gene polymorphism rs7903146 is associated with stroke in type 2 diabetes patients with long disease duration.
24518834 2014 Redundant enhancers and causal variants in the TCF7L2 gene.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24485399 2014 Gender-dependent associations of CDKN2A/2B, KCNJ11, POLI, SLC30A8, and TCF7L2 variants with type 2 diabetes in (North African) Tunisian Arabs.
24463962 2014 Alternative human liver transcripts of TCF7L2 bind to the gluconeogenesis regulator HNF4? at the protein level.
24390345 2014 Sequence variants in SLC16A11 are a common risk factor for type 2 diabetes in Mexico.
24338422 2013 Colorectal cancer susceptibility variants alter risk of breast cancer in a Chinese Han population.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24266846 2013 TCF7L2 rs12255372 (G>T) polymorphism contributes to breast carcinogenesis: evidence from a meta-analysis.
24214952 2013 Association of variant rs7903146 (C/T) single nucleotide polymorphism of TCF7L2 gene with impairment in wound healing among north Indian type 2 diabetes population: a case-control study.
24205231 2013 Plasma metabolomics reveal alterations of sphingo- and glycerophospholipid levels in non-diabetic carriers of the transcription factor 7-like 2 polymorphism rs7903146.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
24157263 2014 Polymorphisms of transcription factor-7-like 2 (TCF7L2) gene in Tunisian women with polycystic ovary syndrome (PCOS).
24128935 2013 Impact of TCF7L2 single nucleotide polymorphisms on hydrochlorothiazide-induced diabetes.
24072042 2014 Tissue-specific differences in the regulation of KIBRA gene expression involve transcription factor TCF7L2 and a complex alternative promoter system.
24059590 2013 The TCF7L2 rs7903146 (T) allele is associated with type 2 diabetes in urban Ghana: a hospital-based case-control study.
24002895 2013 Rs290487 of TCF7L2 gene is not associated with type 2 diabetes in Chinese Han population: a case control study and meta-analysis.
23977356 2013 Limited TCF7L2 expression in MS lesions.
23951231 2013 Association between TCF7L2 gene polymorphism and cancer risk: a meta-analysis.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23942586 2013 Mediterranean diet reduces the adverse effect of the TCF7L2-rs7903146 polymorphism on cardiovascular risk factors and stroke incidence: a randomized controlled trial in a high-cardiovascular-risk population.
23935130 2013 Polymorphisms of TCF7L2 gene in South Brazilian women with polycystic ovary syndrome: a cross-sectional study.
23926018 2013 [Study of the association between SNP rs7903146(C/T) in TCF7L2 and metabolic syndrome in Chinese Korean and Han populations from Yanbian].
23855352 2013 Association of the rs7903146 polymorphism in transcription factor 7-like 2 (TCF7L2) gene with gestational diabetes mellitus: a meta-analysis.
23844215 2013 Henryin, an ent-kaurane diterpenoid, inhibits Wnt signaling through interference with ?-catenin/TCF4 interaction in colorectal cancer cells.
23840876 2013 GRG5/AES interacts with T-cell factor 4 (TCF4) and downregulates Wnt signaling in human cells and zebrafish embryos.
23670970 2013 Genetic modifiers of cystic fibrosis-related diabetes.
23651211 2013 Upregulation of T-cell factor-4 isoform-responsive target genes in hepatocellular carcinoma.
23648141 2013 Loss of exon 4 in a human T-cell factor-4 isoform promotes hepatic tumourigenicity.
23617586 2013 Carriers of a novel frame-shift insertion in WNT16a possess elevated pancreatic expression of TCF7L2.
23613959 2013 Acetylation of human TCF4 (TCF7L2) proteins attenuates inhibition by the HBP1 repressor and induces a conformational change in the TCF4::DNA complex.
23603903 2013 T cell factor 4 is a pro-catabolic and apoptotic factor in human articular chondrocytes by potentiating nuclear factor ?B signaling.
23579632 2013 Association of rs12255372 in the TCF7L2 gene with type 2 diabetes mellitus: a meta-analysis.
23577093 2013 Association of TCF7L2 gene polymorphisms with T2DM in the population of Hyderabad, India.
23558246 2013 Impacts of TCF7L2 gene polymorphisms on the susceptibility of hepatogenous diabetes and hepatocellular carcinoma in cirrhotic patients.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23536853 2013 Association of rs7903146 (IVS3C/T) and rs290487 (IVS3C/T) polymorphisms in TCF7L2 with type 2 diabetes in 9,619 Han Chinese population.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23527206 2013 The association between gene polymorphism of TCF7L2 and type 2 diabetes in Chinese Han population: a meta-analysis.
23504200 2013 ZNRF3 acts as a tumour suppressor by the Wnt signalling pathway in human gastric adenocarcinoma.
23437103 2013 ABCD2 is a direct target of ?-catenin and TCF-4: implications for X-linked adrenoleukodystrophy therapy.
23434931 2013 TCF7L2 variation and proliferative diabetic retinopathy.
23395167 2013 LRP6 enhances glucose metabolism by promoting TCF7L2-dependent insulin receptor expression and IGF receptor stabilization in humans.
23349771 2013 Association study of 25 type 2 diabetes related Loci with measures of obesity in Indian sib pairs.
23311683 2013 Meta-analysis of associations between TCF7L2 polymorphisms and risk of type 2 diabetes mellitus in the Chinese population.
23306204 2013 SOX9 regulates low density lipoprotein receptor-related protein 6 (LRP6) and T-cell factor 4 (TCF4) expression and Wnt/?-catenin activation in breast cancer.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23295773 2013 Unique genome-wide map of TCF4 and STAT3 targets using ChIP-seq reveals their association with new molecular subtypes of glioblastoma.
23295285 2012 Association of the rs7903146 single nucleotide polymorphism at the Transcription Factor 7-like 2 (TCF7L2) locus with type 2 diabetes in Brazilian subjects.
23224985 2013 Nuclear LEF1/TCF4 correlate with poor prognosis but not with nuclear ?-catenin in cerebral metastasis of lung adenocarcinomas.
23209189 2013 Genome-wide association study for type 2 diabetes in Indians identifies a new susceptibility locus at 2q21.
23193183 2013 Transferability and fine mapping of type 2 diabetes loci in African Americans: the Candidate Gene Association Resource Plus Study.
23188737 2013 TCF7L2 gene polymorphisms and type 2 diabetes risk: a comprehensive and updated meta-analysis involving 121,174 subjects.
23144361 2012 Evaluation of genome-wide association study-identified type 2 diabetes loci in African Americans.
23142382 2013 Transcription factor-7-like 2 gene variants are strongly associated with type 2 diabetes in Tunisian Arab subjects.
23107111 2012 Transcription factor-7-like 2 gene variants are strongly associated with type 2 diabetes in Lebanese subjects.
23086040 2012 Adipose tissue TCF7L2 splicing is regulated by weight loss and associates with glucose and fatty acid metabolism.
23085767 2012 Associations between TCF7L2 polymorphisms and risk of breast cancer among Hispanic and non-Hispanic white women: the Breast Cancer Health Disparities Study.
23050589 2012 Association between the IVS4G>T mutation in the TCF7L2 gene and susceptibility to diabetes in cystic fibrosis patients.
23041303 2013 Association between donor and recipient TCF7L2 gene polymorphisms and the risk of new-onset diabetes mellitus after liver transplantation in a Han Chinese population.
23034957 2012 TCF7L2 genetic variants modulate the effect of dietary fat intake on changes in body composition during a weight-loss intervention.
23030478 2013 The expression and significance of WWOX and ?-catenin in hepatocellular carcinoma.
23029137 2012 Inhibition of Tcf-4 induces apoptosis and enhances chemosensitivity of colon cancer cells.
23014255 Relationship of transcription factor 7 like 2 gene rs7903146 variation with type 2 diabetes and obesity related parameters.
23011354 2013 In vitro scan for enhancers at the TCF7L2 locus.
23010200 2013 Association of TCF7L2 gene polymorphisms with type 2 diabetes mellitus in Han Chinese population: a meta-analysis.
22967502 2012 The Wnt signaling pathway effector TCF7L2 is upregulated by insulin and represses hepatic gluconeogenesis.
22951069 2012 Cell type-specific binding patterns reveal that TCF7L2 can be tethered to the genome by association with GATA3.
22945304 2012 TCF7L2 promotes beta cell regeneration in human and mouse pancreas.
22942101 2012 Transcription factor 7-like 2 (TCF7L2) variations associated with earlier age-onset of type 2 diabetes in Thai patients.
22923468 2012 Contribution of common genetic variation to the risk of type 2 diabetes in the Mexican Mestizo population.
22916254 2012 Effects of rs7903146 variation in the Tcf7l2 gene in the lipid metabolism of three different populations.
22911383 2012 TCF7L2 rs7903146 impairs islet function and morphology in non-diabetic individuals.
22885420 2012 Lack of association between the CC genotype of the rs7903146 polymorphism in the TCF7L2 gene and rheumatoid arthritis.
22862926 2013 Incretin and pancreatic hormone secretion in Caucasian non-diabetic carriers of the TCF7L2 rs7903146 risk T allele.
22843023 2013 TCF7L2 gene polymorphisms and type 2 diabetes: association with diabetic retinopathy and cardiovascular autonomic neuropathy.
22805760 2012 The TCF4/?-catenin pathway and chromatin structure cooperate to regulate D-glucuronyl C5-epimerase expression in breast cancer.
22782288 2012 Role of TCF7L2 risk variant and dietary fibre intake on incident type 2 diabetes.
22768190 2012 Loss of the SxxSS motif in a human T-cell factor-4 isoform confers hypoxia resistance to liver cancer: an oncogenic switch in Wnt signaling.
22766303 2012 KLF4 and SOX9 transcription factors antagonize ?-catenin and inhibit TCF-activity in cancer cells.
22712642 2012 TCF7L2 polymorphism and cognitive test performance in cardiovascular disease.
22699938 2012 Kindlin 2 forms a transcriptional complex with ?-catenin and TCF4 to enhance Wnt signalling.
22693455 2012 Stratifying type 2 diabetes cases by BMI identifies genetic risk variants in LAMA1 and enrichment for risk variants in lean compared to obese cases.
22674979 2012 Identification of novel T cell factor 4 (TCF-4) binding sites on the HIV long terminal repeat which associate with TCF-4, ?-catenin, and SMAR1 to repress HIV transcription.
22591707 2012 Genetic prediction of postpartum diabetes in women with gestational diabetes mellitus.
22583123 2012 Association of TCF7L2 and ADIPOQ with body mass index, waist-hip ratio, and systolic blood pressure in an endogamous ethnic group of India.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22558147 2012 Lack of association of type 2 diabetes susceptibility genotypes and body weight on the development of islet autoimmunity and type 1 diabetes.
22552033 2012 Influence of dietary protein intake and glycemic index on the association between TCF7L2 HapA and weight gain.
22524208 2012 Transcription factor 7-like 2 gene polymorphisms and gestational diabetes mellitus.
22487833 2012 [Association analysis of genetic polymorphisms of TCF7L2, CDKAL1, SLC30A8, HHEX genes and microvascular complications of type 2 diabetes mellitus].
22480428 2012 T2D risk haplotypes of the TCF7L2 gene in the Czech population sample: the association with free fatty acids composition.
22443257 2012 Polycystic ovary syndrome is not associated with polymorphisms of the TCF7L2, CDKAL1, HHEX, KCNJ11, FTO and SLC30A8 genes.
22441719 2012 Stronger association of common variants in TCF7L2 gene with nonobese type 2 diabetes in the Latvian population.
22402060 2013 Functional analysis of TCF7L2 genetic variants associated with type 2 diabetes.
22355027 2012 Dietary fiber intake modulates the association between variants in TCF7L2 and weight loss during a lifestyle intervention.
22318732 2012 MUC1-C oncoprotein induces TCF7L2 transcription factor activation and promotes cyclin D1 expression in human breast cancer cells.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
22301903 2012 Association of fibrillin-3 and transcription factor-7-like 2 gene variants with metabolic phenotypes in PCOS.
22296403 2012 Common variants of transcription factor 7-like 2 (TCF7L2) are associated with reduced insulin secretion in women with polycystic ovary syndrome.
22275441 2012 Genetic risk assessment of type 2 diabetes-associated polymorphisms in African Americans.
22258766 2012 SPINDLIN1 promotes cancer cell proliferation through activation of WNT/TCF-4 signaling.
22247771 2012 Association of the type 2 diabetes mellitus susceptibility gene, TCF7L2, with schizophrenia in an Arab-Israeli family sample.
22245614 2012 Genetic variants of TCF7L2 are associated with type 2 diabetes in a northeastern Chinese population.
22232078 2012 Transcription factor TCF4 maintains the properties of human corneal epithelial stem cells.
22231735 2012 Sox4 functions as a positive regulator of ?-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas.
22156527 2012 Role of ?-catenin and TCF/LEF family members in transcriptional activity of HIV in astrocytes.
22155184 2012 ?-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells.
22136959 2011 rs12255372 variant of TCF7L2 gene is protective for obesity in Mexican children.
22109522 2011 Identification of a link between Wnt/?-catenin signalling and the cell fusion pathway.
22109281 2012 The type 2 diabetes-associated variant in TCF7L2 is associated with latent autoimmune diabetes in adult Europeans and the gene effect is modified by obesity: a meta-analysis and an individual study.
22101970 Use of diverse electronic medical record systems to identify genetic risk for type 2 diabetes within a genome-wide association study.
22022540 2011 Human FasL gene is a target of ?-catenin/T-cell factor pathway and complex FasL haplotypes alter promoter functions.
22016394 2011 Tumor-suppressive effects of psoriasin (S100A7) are mediated through the ?-catenin/T cell factor 4 protein pathway in estrogen receptor-positive breast cancer cells.
22014570 2011 FoxM1 promotes ?-catenin nuclear localization and controls Wnt target-gene expression and glioma tumorigenesis.
21983179 2011 Silencing of the Wnt transcription factor TCF4 sensitizes colorectal cancer cells to (chemo-) radiotherapy.
21956205 2012 Genome-wide identification of TCF7L2/TCF4 target miRNAs reveals a role for miR-21 in Wnt-driven epithelial cancer.
21921652 2011 Evaluation of the obesity genes FTO and MC4R and the type 2 diabetes mellitus gene TCF7L2 for contribution to stroke risk: The Mannheim-Heidelberg Stroke Study.
21913056 2011 An alternative polyadenylation signal in TCF7L2 generates isoforms that inhibit T cell factor/lymphoid-enhancer factor (TCF/LEF)-dependent target genes.
21892161 2011 Genomic sequencing of colorectal adenocarcinomas identifies a recurrent VTI1A-TCF7L2 fusion.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21857094 2011 Association of transcription factor 7-like 2 (TCF7L2) gene polymorphism with posttransplant diabetes mellitus in kidney transplant patients medicated with tacrolimus.
21855162 2011 The expression of transcription factor 7-like 2 (TCF7L2) in fat and placental tissue from women with gestational diabetes.
21814547 2011 TCF7L2 polymorphism, weight loss and proinsulin:insulin ratio in the diabetes prevention program.
21772333 2011 Wnt-?-catenin-Tcf-4 signalling-modulated invasiveness is dependent on osteopontin expression in breast cancer.
21764279 2012 Capsaicin represses transcriptional activity of ?-catenin in human colorectal cancer cells.
21720709 2011 ?-catenin/Tcf-4 complex transcriptionally regulates AKT1 in glioma.
21707949 2011 Association of TCF7L2 allelic variations with gastric function, satiation, and GLP-1 levels.
21678030 2012 Association of a common variant in TCF7L2 gene with type 2 diabetes mellitus in a Persian population.
21673050 2011 Alterations in TCF7L2 expression define its role as a key regulator of glucose metabolism.
21641671 2011 Transcription factor 7-like 2 (TCF7L2) gene polymorphism and complication/comorbidity profile in type 2 diabetes patients.
21636708 2011 High ?-catenin/Tcf-4 activity confers glioma progression via direct regulation of AKT2 gene expression.
21599871 2011 Differential LEF1 and TCF4 expression is involved in melanoma cell phenotype switching.
21595284 2011 [Association between polymorphisms of TCF7L2 and type 2 diabetes with special reference to incretin action].
21543200 2012 Dietary saturated fat, gender and genetic variation at the TCF7L2 locus predict the development of metabolic syndrome.
21510814 2011 Association of genetic variations in TCF7L2, SLC30A8, HHEX, LOC387761, and EXT2 with Type 2 diabetes mellitus in Tunisia.
21454679 2011 Zipper-interacting protein kinase (ZIPK) modulates canonical Wnt/beta-catenin signaling through interaction with Nemo-like kinase and T-cell factor 4 (NLK/TCF4).
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21436631 2011 A gene signature distinguishing CD133hi from CD133- colorectal cancer cells: essential role for EGR1 and downstream factors.
21423583 2011 Single nucleotide polymorphisms of TCF7L2 are linked to diabetic coronary atherosclerosis.
21414605 2011 At-risk variant in TCF7L2 for type II diabetes increases risk of schizophrenia.
21388956 2011 Fibroblast growth factor receptor-3 (FGFR-3) regulates expression of paneth cell lineage-specific genes in intestinal epithelial cells through both TCF4/beta-catenin-dependent and -independent signaling pathways.
21384500 2011 Association of TCF7L2 SNPs with age at onset of type 2 diabetes and proinsulin/insulin ratio but not with glucagon-like peptide 1.
21383188 2011 T-cell factor 4 functions as a tumor suppressor whose disruption modulates colon cell proliferation and tumorigenesis.
21357677 2011 TCF7L2 splice variants have distinct effects on beta-cell turnover and function.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21301999 2012 Genetic variations in transcription factor 7-like 2 (TCF7L2) gene: association of TCF7L2 rs12255372(G/T) or rs7903146(C/T) with breast cancer risk and clinico-pathological parameters.
21292023 2011 The ?-catenin/Tcf4/survivin signaling maintains a less differentiated phenotype and high proliferative capacity of human corneal epithelial progenitor cells.
21285352 2011 Phosphorylation of TCF proteins by homeodomain-interacting protein kinase 2.
21256126 2011 Identification of T-cell factor-4 isoforms that contribute to the malignant phenotype of hepatocellular carcinoma cells.
21159844 2011 Variants and haplotypes of TCF7L2 are associated with ?-cell function in patients with newly diagnosed type 2 diabetes: the Verona Newly Diagnosed Type 2 Diabetes Study (VNDS) 1.
21150882 2011 Replication of genetic variants from genome-wide association studies with metabolic traits in an island population of the Adriatic coast of Croatia.
21115178 2011 Pleiotropic effects of TCF7L2 gene variants and its modulation in the metabolic syndrome: from the LIPGENE study.
21109996 2011 Association testing of TCF7L2 polymorphisms with type 2 diabetes in multi-ethnic youth.
20980453 2011 Resequencing and analysis of variation in the TCF7L2 gene in African Americans suggests that SNP rs7903146 is the causal diabetes susceptibility variant.
20967696 2010 Metagenomic study of single-nucleotide polymorphism within candidate genes associated with type 2 diabetes in an Indian population.
20957343 2011 Carriers of the TCF7L2 rs7903146 TT genotype have elevated levels of plasma glucose, serum proinsulin and plasma gastric inhibitory polypeptide (GIP) during a meal test.
20929593 2010 The longitudinal association of common susceptibility variants for type 2 diabetes and obesity with fasting glucose level and BMI.
20923526 2009 Ethnic difference in patients with type 2 diabetes mellitus in inter-East Asian populations: a systematic review and meta-analysis focusing on gene polymorphism.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20878273 2010 Molecular function of TCF7L2: Consequences of TCF7L2 splicing for molecular function and risk for type 2 diabetes.
20873210 2010 [Polymorphic markers TCF7L2 rs12255372 and SLC30A8 rs13266634 confer susceptibility to type 2 diabetes in a Russian population].
20849430 2010 The TCF7L2 diabetes risk variant is associated with HbA?(C) levels: a genome-wide association meta-analysis.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20802253 2010 Glycemia determines the effect of type 2 diabetes risk genes on insulin secretion.
20798759 2010 Role of BMI in the Association of the TCF7L2 rs7903146 Variant with Coronary Heart Disease: The Atherosclerosis Risk in Communities (ARIC) Study.
20739273 2010 p15RS attenuates Wnt/{beta}-catenin signaling by disrupting {beta}-catenin·TCF4 Interaction.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20705583 2010 NGX6 inhibits cell invasion and adhesion through suppression of Wnt/beta-catenin signal pathway in colon cancer.
20696899 2010 TCF4 and CDX2, major transcription factors for intestinal function, converge on the same cis-regulatory regions.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20682688 2010 Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study: common genetic variants in GCK and TCF7L2 are associated with fasting and postchallenge glucose levels in pregnancy and with the new consensus definition of gestational diabetes mellitus from the International Association of Diabetes and Pregnancy Study Groups.
20654575 2010 The balance of TCF7L2 variants with differential activities in Wnt-signaling is regulated by lithium in a GSK3beta-independent manner.
20648057 2010 Potential role of TCF7L2 gene variants on cardiac sympathetic/parasympathetic activity.
20640398 2010 Disease-associated loci are significantly over-represented among genes bound by transcription factor 7-like 2 (TCF7L2) in vivo.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616309 2010 Coronary artery calcification and its relationship to validated genetic variants for diabetes mellitus assessed in the Heinz Nixdorf recall cohort.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20597906 2010 A validation study of type 2 diabetes-related variants of the TCF7L2, HHEX, KCNJ11, and ADIPOQ genes in one endogamous ethnic group of north India.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20578204 2010 Transcription factor 7-like 2 (TCF7L2) polymorphism and context-specific risk of impaired fasting glucose in African American and Caucasian adults: the atherosclerosis risk in communities (ARIC) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20550665 2010 Association study of genetic variants in eight genes/loci with type 2 diabetes in a Han Chinese population.
20546291 2010 Association of TCF7L2 gene variants with low GAD autoantibody titre in LADA subjects (NIRAD Study 5).
20540670 2011 Gestational diabetes mellitus shares polymorphisms of genes associated with insulin resistance and type 2 diabetes in the Greek population.
20532534 2010 TCF-3, 4 protein expression correlates with beta-catenin expression in MSS and MSI-H colorectal cancer from HNPCC patients but not in sporadic colorectal cancers.
20508220 2010 Comment on: Villareal et al. (2009) TCF7L2 variant rs7903146 affects the risk of type 2 diabetes by modulating incretin action. Diabetes;59:479-485.
20503258 2010 Candidate gene association study conditioning on individual ancestry in patients with type 2 diabetes and metabolic syndrome from Mexico City.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20485196 2010 Impaired glucose tolerance and insulin resistance in survivors of childhood acute lymphoblastic leukemia: prevalence and risk factors.
20478041 2010 The transcription factor 7-like 2 (TCF7L2) polymorphism may be associated with focal arteriolar narrowing in Caucasians with hypertension or without diabetes: the ARIC Study.
20459822 2010 The promoter for intestinal cell kinase is head-to-head with F-Box 9 and contains functional sites for TCF7L2 and FOXA factors.
20437825 2010 Relationship of five type 2 diabetes candidate gene polymorphisms to the age at diagnosis of diabetes in the Slovakian population.
20424228 2010 Impact of common variants of PPARG, KCNJ11, TCF7L2, SLC30A8, HHEX, CDKN2A, IGF2BP2, and CDKAL1 on the risk of type 2 diabetes in 5,164 Indians.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20372961 2010 Beta-catenin/TCF4 transactivates miR-30e during intestinal cell differentiation.
20361036 2010 Gene-gene interactions lead to higher risk for development of type 2 diabetes in an Ashkenazi Jewish population.
20299486 2010 Transcription factor 7-like 2 (TCF7L2) polymorphism and hyperglycemia in an adult Italian population-based cohort.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20215779 2009 Evidence of interaction between type 2 diabetes susceptibility genes and dietary fat intake for adiposity and glucose homeostasis-related phenotypes.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20161779 2010 Investigation of type 2 diabetes risk alleles support CDKN2A/B, CDKAL1, and TCF7L2 as susceptibility genes in a Han Chinese cohort.
20142250 2010 Diabetes genes and prostate cancer in the Atherosclerosis Risk in Communities study.
20128911 2010 SLUG: a new target of lymphoid enhancer factor-1 in human osteoblasts.
20122174 2010 Axin downregulates TCF-4 transcription via beta-catenin, but not p53, and inhibits the proliferation and invasion of lung cancer cells.
20118932 2010 A map of open chromatin in human pancreatic islets.
20107109 2010 The T-allele of TCF7L2 rs7903146 associates with a reduced compensation of insulin secretion for insulin resistance induced by 9 days of bed rest.
20097709 2010 Genotype and tissue-specific effects on alternative splicing of the transcription factor 7-like 2 gene in humans.
20095040 2010 FOXO1 and TCF7L2 genes involved in metastasis and poor prognosis in clear cell renal cell carcinoma.
20092643 2010 Large effects on body mass index and insulin resistance of fat mass and obesity associated gene (FTO) variants in patients with polycystic ovary syndrome (PCOS).
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20081857 2010 Genetic variation in GIPR influences the glucose and insulin responses to an oral glucose challenge.
20075150 2010 Utility of genetic and non-genetic risk factors in prediction of type 2 diabetes: Whitehall II prospective cohort study.
20054294 2010 KCNJ11 Lys23Glu and TCF7L2 rs290487(C/T) polymorphisms affect therapeutic efficacy of repaglinide in Chinese patients with type 2 diabetes.
20043145 2010 Improvements in glucose homeostasis in response to regular exercise are influenced by the PPARG Pro12Ala variant: results from the HERITAGE Family Study.
20041287 2010 Polymorphisms of TCF7L2 and HHEX genes in Chinese women with polycystic ovary syndrome.
20033802 2010 Evidence for neuroendocrine function of a unique splicing form of TCF7L2 in human brain, islets and gut.
20032493 2010 TCF7L2 rs7903146-macronutrient interaction in obese individuals' responses to a 10-wk randomized hypoenergetic diet.
20028944 2010 Gene variants of TCF7L2 influence weight loss and body composition during lifestyle intervention in a population at risk for type 2 diabetes.
20027603 2010 Enhanced expression of proproliferative and antiapoptotic genes in ulcerative colitis-associated neoplasia.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19934000 2010 TCF7L2 variant rs7903146 affects the risk of type 2 diabetes by modulating incretin action.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19924301 2009 Control of TCF-4 expression by VDR and vitamin D in the mouse mammary gland and colorectal cancer cell lines.
19924244 2009 TCF7L2 polymorphism rs7903146 is associated with coronary artery disease severity and mortality.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19895682 2009 No effect of cancer-associated SNP rs6983267 in the 8q24 region on co-expression of MYC and TCF7L2 in normal colon tissue.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19864407 2009 Effects of TCF7L2 polymorphisms on glucose values after a lifestyle intervention.
19833889 2010 Genetic heterogeneity in latent autoimmune diabetes is linked to various degrees of autoimmune activity: results from the Nord-Trøndelag Health Study.
19825152 2009 TCF7L2 polymorphisms and inflammatory markers before and after treatment with fenofibrate.
19816403 2009 The kinase TNIK is an essential activator of Wnt target genes.
19808892 2010 Combined risk allele score of eight type 2 diabetes genes is associated with reduced first-phase glucose-stimulated insulin secretion during hyperglycemic clamps.
19806338 2010 TCF7L2 genetic variants and progression to diabetes in the Chinese population: pleiotropic effects on insulin secretion and insulin resistance.
19794065 2010 Polygenic risk variants for type 2 diabetes susceptibility modify age at diagnosis in monogenic HNF1A diabetes.
19789636 2009 Alternative splicing of TCF7L2 gene in omental and subcutaneous adipose tissue and risk of type 2 diabetes.
19760027 2009 Association of common polymorphisms in IL10, and in other genes related to inflammatory response and obesity with colorectal cancer.
19741467 2009 Association of common type 2 diabetes risk gene variants and posttransplantation diabetes mellitus in renal allograft recipients in Korea.
19734900 2009 Genetic variant near IRS1 is associated with type 2 diabetes, insulin resistance and hyperinsulinemia.
19732438 2009 No association between a candidate TCF7L2 variant and risk of breast or ovarian cancer.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19718565 2010 Genetic variants of cyclin-dependent kinase 5 regulatory subunit associated protein 1-like 1 and transcription factor 7-like 2 are not associated with polycystic ovary syndrome in Chinese women.
19713311 2009 TCF7L2 polymorphism associates with new-onset diabetes after transplantation.
19679347 2009 Activation of beta-catenin signalling increases StarD7 gene expression in JEG-3 cells.
19643578 2009 Genetic risk factors for type 2 diabetes with pharmacologic intervention in African-American patients with schizophrenia or schizoaffective disorder.
19636253 2009 Evaluation of risk prediction updates from commercial genome-wide scans.
19615048 2009 Type 2 diabetes gene TCF7L2 polymorphism is not associated with fetal and postnatal growth in two birth cohort studies.
19602701 2009 Underlying genetic models of inheritance in established type 2 diabetes associations.
19602480 2009 Tissue-specific alternative splicing of TCF7L2.
19592620 2009 Examination of type 2 diabetes loci implicates CDKAL1 as a birth weight gene.
19585101 2009 A susceptibility gene for type 2 diabetes confers substantial risk for diabetes complicating cystic fibrosis.
19573884 2009 Preliminary report: No association between TCF7L2 rs7903146 and euglycemic-clamp-derived insulin sensitivity in a mixed-age cohort.
19563778 2009 Daxx positively modulates beta-catenin/TCF4-mediated transcriptional potential.
19533015 2010 Transcription factor 7-like 2-gene polymorphism is related to fasting C peptide in latent autoimmune diabetes in adults (LADA).
19509102 2009 Genetic variants of TCF7L2 are associated with insulin resistance and related metabolic phenotypes in Taiwanese adolescents and Caucasian young adults.
19506043 2009 Association and interaction analyses of genetic variants in ADIPOQ, ENPP1, GHSR, PPARgamma and TCF7L2 genes for diabetic nephropathy in a Taiwanese population with type 2 diabetes.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19497595 2009 Genetic variation of FTO and TCF7L2 in premature adrenarche.
19482368 2009 Meta-analysis of the association between SNPs in TCF7L2 and type 2 diabetes in East Asian population.
19473183 2010 Interactions between TCF7L2 genotype and growth hormone-induced changes in glucose homeostasis in small for gestational age children.
19443654 2009 MAD2B, a novel TCF4-binding protein, modulates TCF4-mediated epithelial-mesenchymal transdifferentiation.
19401414 2009 Confirmation of multiple risk Loci and genetic impacts by a genome-wide association study of type 2 diabetes in the Japanese population.
19386626 2009 Decreased TCF7L2 protein levels in type 2 diabetes mellitus correlate with downregulation of GIP- and GLP-1 receptors and impaired beta-cell function.
19380854 2009 Joint effects of common genetic variants on the risk for type 2 diabetes in U.S. men and women of European ancestry.
19368707 2009 Contribution of type 2 diabetes associated loci in the Arabic population from Tunisia: a case-control study.
19351735 2009 Evidence for association between polycystic ovary syndrome (PCOS) and TCF7L2 and glucose intolerance in women with PCOS and TCF7L2.
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19288077 2009 The T allele of rs7903146 TCF7L2 is associated with impaired insulinotropic action of incretin hormones, reduced 24 h profiles of plasma insulin and glucagon, and increased hepatic glucose production in young healthy men.
19286335 2010 TCF7L2 is associated with type 2 diabetes in nonobese individuals from Tunisia.
19279076 2009 Genetic predisposition, Western dietary pattern, and the risk of type 2 diabetes in men.
19269971 2009 Structure and regulation of the versican promoter: the versican promoter is regulated by AP-1 and TCF transcription factors in invasive human melanoma cells.
19267370 2009 Association of IL10 and other immune response- and obesity-related genes with prostate cancer in CLUE II.
19258437 2009 Genetic variant in the IGF2BP2 gene may interact with fetal malnutrition to affect glucose metabolism.
19258404 2009 The inhibitory effect of recent type 2 diabetes risk loci on insulin secretion is modulated by insulin sensitivity.
19252133 2009 Interrogating type 2 diabetes genome-wide association data using a biological pathway-based approach.
19247628 2009 Unique splicing pattern of the TCF7L2 gene in human pancreatic islets.
19247372 2009 Construction of a prediction model for type 2 diabetes mellitus in the Japanese population based on 11 genes with strong evidence of the association.
19228405 2009 Association between TCF7L2 gene polymorphisms and susceptibility to type 2 diabetes mellitus: a large Human Genome Epidemiology (HuGE) review and meta-analysis.
19225753 2009 Interaction between prenatal growth and high-risk genotypes in the development of type 2 diabetes.
19221600 2009 Genetic variants of Wnt transcription factor TCF-4 (TCF7L2) putative promoter region are associated with small intestinal Crohn's disease.
19211816 2009 TCF7L2, dietary carbohydrate, and risk of type 2 diabetes in US women.
19183934 2009 TCF7L2 variants are associated with increased proinsulin/insulin ratios but not obesity traits in the Framingham Heart Study.
19172244 2009 The risk allele load accelerates the age-dependent decline in beta cell function.
19169495 2008 Allele-specific PCR assay to genotype SNP rs7903146 in TCF7L2 gene for rapid screening of diabetes susceptibility.
19168596 2009 TCF7L2 regulates late events in insulin secretion from pancreatic islet beta-cells.
19156536 2009 In vitro modulation of TCF7L2 gene expression in human pancreatic cells.
19149908 2009 Whole-grain consumption and transcription factor-7-like 2 ( TCF7L2) rs7903146: gene-diet interaction in modulating type 2 diabetes risk.
19141698 2009 Polyunsaturated fatty acids modulate the effect of TCF7L2 gene variants on postprandial lipemia.
19141695 2009 Prolonged saturated fat-induced, glucose-dependent insulinotropic polypeptide elevation is associated with adipokine imbalance and liver injury in nonalcoholic steatohepatitis: dysregulated enteroadipocyte axis as a novel feature of fatty liver.
19139842 2009 Risk prediction of prevalent diabetes in a Swiss population using a weighted genetic score--the CoLaus Study.
19131553 2009 Gene expression profiling of ATL patients: compilation of disease-related genes and evidence for TCF4 involvement in BIRC5 gene expression and cell viability.
19124064 2009 The Bcl-w promoter is activated by beta-catenin/TCF4 in human colorectal carcinoma cells.
19105201 2009 Transcription factor 7-like 2 polymorphism modulates glucose and lipid homeostasis, adipokine profile, and hepatocyte apoptosis in NASH.
19082521 2009 Association between insulin secretion, insulin sensitivity and type 2 diabetes susceptibility variants identified in genome-wide association studies.
19057525 2009 Association analyses between type 2 diabetes genes and obesity traits in pigs.
19056611 2009 Adiposity-related heterogeneity in patterns of type 2 diabetes susceptibility observed in genome-wide association data.
19055834 2008 TCF7L2 variant genotypes and type 2 diabetes risk in Brazil: significant association, but not a significant tool for risk stratification in the general population.
19053027 2009 Loci of TCF7L2, HHEX and IDE on chromosome 10q and the susceptibility of their genetic polymorphisms to type 2 diabetes.
19050058 2009 Single nucleotide transcription factor 7-like 2 (TCF7L2) gene polymorphisms in antiislet autoantibody-negative patients at onset of diabetes.
19033397 2009 Replication study of candidate genes associated with type 2 diabetes based on genome-wide screening.
19020324 2008 Clinical risk factors, DNA variants, and the development of type 2 diabetes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
19012045 2008 Common coding variant in the TCF7L2 gene and study of the association with type 2 diabetes in Japanese subjects.
19002430 2009 Type 2 diabetes-associated genetic variants discovered in the recent genome-wide association studies are related to gestational diabetes mellitus in the Korean population.
18996470 2009 Rapid and cost effective genotyping method for polymorphisms in PPARG, PPARGC1 and TCF7L2 genes.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18992165 2008 Clinicopathological significance of expression of p-c-Jun, TCF4 and beta-Catenin in colorectal tumors.
18984664 2009 Common type 2 diabetes risk gene variants associate with gestational diabetes.
18972257 2009 Comparison of genetic risk in three candidate genes (TCF7L2, PPARG, KCNJ11) with traditional risk factors for type 2 diabetes in a population-based study--the HUNT study.
18958766 2008 Genetic variants in TCF7L2 and KCNJ11 genes in a Greek population with polycystic ovary syndrome.
18931037 2009 Transcription factor 7-like 2 (TCF7L2) polymorphism and context-specific risk of type 2 diabetes in African American and Caucasian adults: the Atherosclerosis Risk in Communities study.
18853134 2008 The search for putative unifying genetic factors for components of the metabolic syndrome.
18839133 2008 Common variants in the TCF7L2 gene help to differentiate autoimmune from non-autoimmune diabetes in young (15-34 years) but not in middle-aged (40-59 years) diabetic patients.
18823720 2008 WITHDRAWN: Effect of TCF7L2 polymorphism on the genetic susceptibility to obesity in the Tunisian population.
18806947 2009 TCF7L2 expression in diabetic patients undergoing bariatric surgery.
18799618 2008 Snail and Slug promote epithelial-mesenchymal transition through beta-catenin-T-cell factor-4-dependent expression of transforming growth factor-beta3.
18772112 2008 RUNX3 attenuates beta-catenin/T cell factors in intestinal tumorigenesis.
18762805 2008 Evidence for an influence of TCF7L2 polymorphism rs7903146 on insulin resistance and sensitivity indices in overweight children and adolescents during a lifestyle intervention.
18755497 2009 Frameshift mutations of Wnt pathway genes AXIN2 and TCF7L2 in gastric carcinomas with high microsatellite instability.
18719881 2008 Beta cell glucose sensitivity is decreased by 39% in non-diabetic individuals carrying multiple diabetes-risk alleles compared with those with no risk alleles.
18712344 2008 Association of variants of the TCF7L2 gene with increases in the risk of type 2 diabetes and the proinsulin:insulin ratio in the Spanish population.
18706099 2008 TCF7L2 gene polymorphisms do not predict susceptibility to diabetes in tropical calcific pancreatitis but may interact with SPINK1 and CTSB mutations in predicting diabetes.
18702948 2008 TCF7L2 gene expression in human visceral and subcutaneous adipose tissue is differentially regulated but not associated with type 2 diabetes mellitus.
18694974 2008 Predicting type 2 diabetes based on polymorphisms from genome-wide association studies: a population-based study.
18689695 2008 Predicting diabetes: clinical, biological, and genetic approaches: data from the Epidemiological Study on the Insulin Resistance Syndrome (DESIR).
18655717 2008 Weak or no association of TCF7L2 variants with Type 2 diabetes risk in an Arab population.
18650481 2008 TCF7L2 variants associate with CKD progression and renal function in population-based cohorts.
18621708 2008 A genome-wide RNAi screen for Wnt/beta-catenin pathway components identifies unexpected roles for TCF transcription factors in cancer.
18611970 2008 Impact of TCF7L2 rs7903146 on insulin secretion and action in young and elderly Danish twins.
18599616 2008 The Wnt signaling pathway effector TCF7L2 and type 2 diabetes mellitus.
18598350 2008 Impact of nine common type 2 diabetes risk polymorphisms in Asian Indian Sikhs: PPARG2 (Pro12Ala), IGF2BP2, TCF7L2 and FTO variants confer a significant risk.
18597214 2008 Variants of the PPARG, IGF2BP2, CDKAL1, HHEX, and TCF7L2 genes confer risk of type 2 diabetes independently of BMI in the German KORA studies.
18591388 2008 Assessing the combined impact of 18 common genetic variants of modest effect sizes on type 2 diabetes risk.
18555673 2009 The effect of WNT5B IVS3C>G on the susceptibility to type 2 diabetes in UK Caucasian subjects.
18546086 2008 TCF7L2 polymorphism rs7903146 and predisposition for type 2 diabetes mellitus in obese children.
18541996 2008 The transcription factor 7-like 2 gene and increased risk of type 2 diabetes: an update.
18519685 2008 Defective claudin-7 regulation by Tcf-4 and Sox-9 disrupts the polarity and increases the tumorigenicity of colorectal cancer cells.
18516622 2008 Type 2 diabetes susceptibility loci in the Ashkenazi Jewish population.
18498634 2008 The genetic susceptibility to type 2 diabetes may be modulated by obesity status: implications for association studies.
18493736 2008 Exon sequencing and association analysis of polymorphisms in TCF7L2 with type 2 diabetes in a Chinese population.
18478343 2008 Association of the TCF7L2 polymorphism with colorectal cancer and adenoma risk.
18469204 2008 Implication of genetic variants near TCF7L2, SLC30A8, HHEX, CDKAL1, CDKN2A/B, IGF2BP2, and FTO in type 2 diabetes and obesity in 6,719 Asians.
18461161 2008 Post genome-wide association studies of novel genes associated with type 2 diabetes show gene-gene interaction and high predictive value.
18445358 2008 TCF7L2 genetic defect and type 2 diabetes.
18443202 2008 Association analysis in african americans of European-derived type 2 diabetes single nucleotide polymorphisms from whole-genome association studies.
18439914 2008 Regulation of Wnt signaling by the nuclear pore complex.
18437354 2008 TCF7L2 single nucleotide polymorphisms, cardiovascular disease and all-cause mortality: the Atherosclerosis Risk in Communities (ARIC) study.
18398040 2008 Transcription factor 7-like 2 polymorphism and colon cancer.
18397358 2008 TCF7L2 polymorphisms are associated with type 2 diabetes in Khatri Sikhs from North India: genetic variation affects lipid levels.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18347071 2008 Nuclear Dvl, c-Jun, beta-catenin, and TCF form a complex leading to stabilization of beta-catenin-TCF interaction.
18342627 2008 Expression of the transcription factor 7-like 2 gene (TCF7L2) in human adipocytes is down regulated by insulin.
18310307 2008 Genetic similarities between latent autoimmune diabetes in adults, type 1 diabetes, and type 2 diabetes.
18302196 2008 Evaluation of a variant in the transcription factor 7-like 2 (TCF7L2) gene and prostate cancer risk in a population-based study.
18291022 2008 Common variants of the TCF7L2 gene are associated with increased risk of type 2 diabetes mellitus in a UK-resident South Asian population.
18288125 2008 TCF7L2 alleles and metabolic syndrome in non-diabetic obese hypertensive patients.
18282631 2008 Association of TCF7L2 polymorphism with diabetes mellitus, metabolic syndrome, and markers of beta cell function and insulin resistance in a population-based sample of Emirati subjects.
18268068 2008 Variation in TCF7L2 and increased risk of colon cancer: the Atherosclerosis Risk in Communities (ARIC) Study.
18268006 2008 Genome-wide pattern of TCF7L2/TCF4 chromatin occupancy in colorectal cancer cells.
18264689 2008 Polymorphisms in the TCF7L2, CDKAL1 and SLC30A8 genes are associated with impaired proinsulin conversion.
18257044 2008 Autoregulation of XTcf-4 depends on a Lef/Tcf site on the XTcf-4 promoter.
18248681 2008 Prevalence of common disease-associated variants in Asian Indians.
18239663 2008 Effects of TCF7L2 polymorphisms on obesity in European populations.
18216022 2008 Glucagon-like peptide-1 activation of TCF7L2-dependent Wnt signaling enhances pancreatic beta cell proliferation.
18203713 2008 The effects of myostatin on adipogenic differentiation of human bone marrow-derived mesenchymal stem cells are mediated through cross-communication between Smad3 and Wnt/beta-catenin signaling pathways.
18193033 2008 TBL1-TBLR1 and beta-catenin recruit each other to Wnt target-gene promoter for transcription activation and oncogenesis.
18166673 2007 Electrophoretic techniques applied to the detection and analysis of the human microsatellite DG10s478.
18097733 2008 Association of TCF7L2 polymorphisms with susceptibility to type 2 diabetes in 4,087 Japanese subjects.
18072015 2008 The DG10S478 variant in the TCF7L2 gene is not associated with microvascular complications in type 2 diabetes.
18071026 2008 Transcription factor 7-like 2 regulates beta-cell survival and function in human pancreatic islets.
18048388 2008 Downregulation of Dkk3 activates beta-catenin/TCF-4 signaling in lung cancer.
18039847 2008 Myeloid translocation gene family members associate with T-cell factors (TCFs) and influence TCF-dependent transcription.
17983804 2007 Functional interaction of DNA topoisomerase IIalpha with the beta-catenin and T-cell factor-4 complex.
17977958 2008 Impact of common type 2 diabetes risk polymorphisms in the DESIR prospective study.
17972059 2008 TCF7L2 is associated with high serum triacylglycerol and differentially expressed in adipose tissue in families with familial combined hyperlipidaemia.
17971425 2008 Association of TCF7L2 gene polymorphisms with reduced acute insulin response in Hispanic Americans.
17934151 2008 A variant of the transcription factor 7-like 2 (TCF7L2) gene and the risk of posttransplantation diabetes mellitus in renal allograft recipients.
17909099 2007 TCF7L2 is not a major susceptibility gene for type 2 diabetes in Pima Indians: analysis of 3,501 individuals.
17901222 2007 Testing the gene or testing a variant? The case of TCF7L2.
17875931 2007 Sox17 and Sox4 differentially regulate beta-catenin/T-cell factor activity and proliferation of colon carcinoma cells.
17873903 2008 Coiled-coil domain containing 85B suppresses the beta-catenin activity in a p53-dependent manner.
17805508 2007 Disparate genetic influences on polycystic ovary syndrome (PCOS) and type 2 diabetes revealed by a lack of association between common variants within the TCF7L2 gene and PCOS.
17768662 2007 Overexpression of axin downregulates TCF-4 and inhibits the development of lung cancer.
17725629 2007 The transcription factor 7-like 2 (TCF7L2) gene is associated with Type 2 diabetes in UK community-based cases, but the risk allele frequency is reduced compared with UK cases selected for genetic studies.
17709525 2007 The Paneth cell alpha-defensin deficiency of ileal Crohn's disease is linked to Wnt/Tcf-4.
17697858 2007 The rs12255372(G/T) and rs7903146(C/T) polymorphisms of the TCF7L2 gene are associated with type 2 diabetes mellitus in Asian Indians.
17683561 2007 The TCF7L2 locus and type 1 diabetes.
17671651 2007 Mechanisms by which common variants in the TCF7L2 gene increase risk of type 2 diabetes.
17668382 2007 Type 2 diabetes whole-genome association study in four populations: the DiaGen consortium.
17665514 2006 Common variants in the TCF7L2 gene and predisposition to type 2 diabetes in UK European Whites, Indian Asians and Afro-Caribbean men and women.
17661009 2007 Impaired glucagon-like peptide-1-induced insulin secretion in carriers of transcription factor 7-like 2 (TCF7L2) gene polymorphisms.
17659738 2007 Novel mutations and sequence variants in exons 3-9 of human T cell factor-4 gene in sporadic rectal cancer patients stratified by microsatellite instability.
17653210 2007 Genetic variations associated with diabetic nephropathy and type II diabetes in a Japanese population.
17618413 2007 Variants of the TCF7L2 gene are associated with beta cell dysfunction and confer an increased risk of type 2 diabetes mellitus in the ULSAM cohort of Swedish elderly men.
17609304 2007 Replication and identification of novel variants at TCF7L2 associated with type 2 diabetes in Hong Kong Chinese.
17601994 2007 Variants of the transcription factor 7-like 2 (TCF7L2) gene are associated with type 2 diabetes in an African-American population enriched for nephropathy.
17593304 2007 TCF7L2 rs7903146 variant does not associate with smallness for gestational age in the French population.
17579832 2007 Transcription factor 7-like 2 polymorphisms and type 2 diabetes, glucose homeostasis traits and gene expression in US participants of European and African descent.
17579206 2007 Association study of the genetic polymorphisms of the transcription factor 7-like 2 (TCF7L2) gene and type 2 diabetes in the Chinese population.
17563454 2007 The new type 2 diabetes gene TCF7L2.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17540954 2007 Variation of the transcription factor 7-like 2 (TCF7L2) gene predicts impaired fasting glucose in healthy young adults: the Cardiovascular Risk in Young Finns Study.
17519421 2007 Variation in TCF7L2 influences therapeutic response to sulfonylureas: a GoDARTs study.
17503332 2007 Type 2 diabetes TCF7L2 risk genotypes alter birth weight: a study of 24,053 individuals.
17476472 2007 TCF7L2 is reproducibly associated with type 2 diabetes in various ethnic groups: a global meta-analysis.
17470138 2007 Association of TCF7L2 polymorphisms with type 2 diabetes in Mexico City.
17463249 2007 Replication of genome-wide association signals in UK samples reveals risk loci for type 2 diabetes.
17463248 2007 A genome-wide association study of type 2 diabetes in Finns detects multiple susceptibility variants.
17463246 2007 Genome-wide association analysis identifies loci for type 2 diabetes and triglyceride levels.
17460697 2007 A variant in CDKAL1 influences insulin response and risk of type 2 diabetes.
17456004 2007 Selective translational repression of truncated proteins from frameshift mutation-derived mRNAs in tumors.
17437080 2007 Variants of transcription factor 7-like 2 (TCF7L2) gene predict conversion to type 2 diabetes in the Finnish Diabetes Prevention Study and are associated with impaired glucose regulation and impaired insulin secretion.
17429603 2007 TCF7L2 in the Go-DARTS study: evidence for a gene dose effect on both diabetes susceptibility and control of glucose levels.
17416797 2007 TCF7L2 polymorphisms modulate proinsulin levels and beta-cell function in a British Europid population.
17392368 2007 Human immunodeficiency virus-restricted replication in astrocytes and the ability of gamma interferon to modulate this restriction are regulated by a downstream effector of the Wnt signaling pathway.
17351281 2007 Additive effects of obesity and TCF7L2 variants on risk for type 2 diabetes among cardiac patients.
17342473 2007 A variant in the transcription factor 7-like 2 (TCF7L2) gene is associated with an increased risk of gestational diabetes mellitus.
17340123 2007 Replication study for the association of TCF7L2 with susceptibility to type 2 diabetes in a Japanese population.
17317761 2007 Transcription factor 7-like 2 (TCF7L2) is associated with gestational diabetes mellitus and interacts with adiposity to alter insulin secretion in Mexican Americans.
17311858 2007 TCF7L2 gene polymorphisms confer an increased risk for early impairment of glucose metabolism and increased height in obese children.
17293876 2007 A genome-wide association study identifies novel risk loci for type 2 diabetes.
17283121 2007 Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling.
17259383 2007 Haplotypes of transcription factor 7-like 2 (TCF7L2) gene and its upstream region are associated with type 2 diabetes and age of onset in Mexican Americans.
17245589 2007 A genetic variation of the transcription factor 7-like 2 gene is associated with risk of type 2 diabetes in the Japanese population.
17245407 2007 TCF7L2 polymorphisms are associated with type 2 diabetes in northern Sweden.
17226113 2007 Variants of the transcription factor 7-like 2 gene (TCF7L2) are strongly associated with type 2 diabetes but not with the metabolic syndrome in the MONICA/KORA surveys.
17181866 2006 Effects of the diabetes linked TCF7L2 polymorphism in a representative older population.
17143297 2006 Colorectal cancer and genetic alterations in the Wnt pathway.
17130514 2006 Polymorphism in the transcription factor 7-like 2 (TCF7L2) gene is associated with reduced insulin secretion in nondiabetic women.
17122440 2006 Regulation of smooth muscle cell proliferation by beta-catenin/T-cell factor signaling involves modulation of cyclin D1 and p21 expression.
17109766 2006 Transcription factor 7-like 2 (TCF7L2) variant is associated with familial breast cancer risk: a case-control study.
17093941 2007 Common variants in the TCF7L2 gene are strongly associated with type 2 diabetes mellitus in the Indian population.
17093940 2007 No major contribution of TCF7L2 sequence variants to maturity onset of diabetes of the young (MODY) or neonatal diabetes mellitus in French white subjects.
17091236 2006 A high mobility group box-containing transcription factor leads to diabetes risk.
17072303 2006 A Wnt-Axin2-GSK3beta cascade regulates Snail1 activity in breast cancer cells.
17065361 2006 TCF7L2 variation predicts hyperglycemia incidence in a French general population: the data from an epidemiological study on the Insulin Resistance Syndrome (DESIR) study.
17063324 2007 Analysis of the type 2 diabetes gene, TCF7L2, in 13,795 type 1 diabetes cases and control subjects.
17052462 2006 Crystal structure of a beta-catenin/BCL9/Tcf4 complex.
17031610 2007 Association of variants of transcription factor 7-like 2 (TCF7L2) with susceptibility to type 2 diabetes in the Dutch Breda cohort.
17020404 2006 Combining information from common type 2 diabetes risk polymorphisms improves disease prediction.
17003360 2006 Transcription factor TCF7L2 genetic study in the French population: expression in human beta-cells and adipose tissue and strong association with type 2 diabetes.
17003358 2006 Common single nucleotide polymorphisms in TCF7L2 are reproducibly associated with type 2 diabetes and reduce the insulin response to glucose in nondiabetic individuals.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16950124 2006 Wnt signaling inhibitors regulate the transcriptional response to morphogenetic Shh-Gli signaling in the neural tube.
16936218 2006 Polymorphisms in the transcription factor 7-like 2 (TCF7L2) gene are associated with type 2 diabetes in the Amish: replication and evidence for a role in both insulin secretion and insulin resistance.
16936217 2006 Association of transcription factor 7-like 2 (TCF7L2) variants with type 2 diabetes in a Finnish sample.
16936216 2006 Variant of transcription factor 7-like 2 (TCF7L2) gene and the risk of type 2 diabetes in large cohorts of U.S. women and men.
16936215 2006 Association analysis of 6,736 U.K. subjects provides replication and confirms TCF7L2 as a type 2 diabetes susceptibility gene with a substantial effect on individual risk.
16855264 2006 TCF7L2 polymorphisms and progression to diabetes in the Diabetes Prevention Program.
16724116 2006 HIC1 attenuates Wnt signaling by recruitment of TCF-4 and beta-catenin to the nuclear bodies.
16714285 2006 NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF).
16690926 2006 Human immunodeficiency virus type 1 Tat prevents dephosphorylation of Sp1 by TCF-4 in astrocytes.
16569639 2006 Physiological and functional interactions between Tcf4 and Daxx in colon cancer cells.
16547505 2006 TCF-4 isoforms absent in TCF-4 mutated MSI-H colorectal cancer cells colocalize with nuclear CtBP and repress TCF-4-mediated transcription.
16532032 2006 Repressor roles for TCF-4 and Sfrp1 in Wnt signaling in breast cancer.
16442529 2006 Bcr interferes with beta-catenin-Tcf1 interaction.
16434966 2006 The C/EBP homologous protein CHOP (GADD153) is an inhibitor of Wnt/TCF signals.
16415884 2006 Variant of transcription factor 7-like 2 (TCF7L2) gene confers risk of type 2 diabetes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16311123 2005 Nuclear translocations of beta-catenin and TCF4 in gastric cancers correlate with lymph node metastasis but probably not with CD44 expression.
16291872 2006 Positive inter-regulation between beta-catenin/T cell factor-4 signaling and endothelin-1 signaling potentiates proliferation and survival of prostate cancer cells.
16204248 2005 TIS7 regulation of the beta-catenin/Tcf-4 target gene osteopontin (OPN) is histone deacetylase-dependent.
16007074 2005 Interaction of phosphorylated c-Jun with TCF4 regulates intestinal cancer development.
15905022 2006 Genetic and cellular characterizations of human TCF4 with microsatellite instability in colon cancer and leukemia cell lines.
15853773 2005 The human D-glucuronyl C5-epimerase gene is transcriptionally activated through the beta-catenin-TCF4 pathway.
15806138 2005 Upregulation of TCF4 expression as a transcriptional target of beta-catenin/p300 complexes during trans-differentiation of endometrial carcinoma cells.
15670774 2005 Quercetin, a potent inhibitor against beta-catenin/Tcf signaling in SW480 colon cancer cells.
15591320 2005 Systematic peptide array-based delineation of the differential beta-catenin interaction with Tcf4, E-cadherin, and adenomatous polyposis coli.
15578569 2005 T-cell factor-4-dependent up-regulation of fibronectin is involved in fibroblast growth factor-2-induced tube formation by endothelial cells.
15525634 2005 TCF-4 mediates cell type-specific regulation of proglucagon gene expression by beta-catenin and glycogen synthase kinase-3beta.
15514942 2005 Overexpression of human pituitary tumor transforming gene (hPTTG), is regulated by beta-catenin /TCF pathway in human esophageal squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331612 2004 Activator protein 2alpha associates with adenomatous polyposis coli/beta-catenin and Inhibits beta-catenin/T-cell factor transcriptional activity in colorectal cancer cells.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15040893 2004 Aberrant expression and function of TCF4 in the proliferation of hepatocellular carcinoma cell line BEL-7402.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661054 2004 Plakoglobin (gamma-catenin) has TCF/LEF family-dependent transcriptional activity in beta-catenin-deficient cell line.
12861022 2003 T-cell factor 4N (TCF-4N), a novel isoform of mouse TCF-4, synergizes with beta-catenin to coactivate C/EBPalpha and steroidogenic factor 1 transcription factors.
12799378 2003 A direct beta-catenin-independent interaction between androgen receptor and T cell factor 4.
12727872 2003 Sumoylation is involved in beta-catenin-dependent activation of Tcf-4.
12556497 2003 Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446687 2003 Identification of a promoter-specific transcriptional activation domain at the C terminus of the Wnt effector protein T-cell factor 4.
12408868 2002 The beta-catenin/TCF-4 complex imposes a crypt progenitor phenotype on colorectal cancer cells.
12408825 2002 ICAT inhibits beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules.
12378619 2002 Association of hTcf-4 gene expression and mutation with clinicopathological characteristics of hepatocellular carcinoma.
12368361 2002 Evidence for regulation of long terminal repeat transcription by Wnt transcription factor TCF-4 in human astrocytic cells.
11980438 2002 Functional MDR1 polymorphisms (G2677T and C3435T) and TCF4 mutations in colorectal tumors with high microsatellite instability.
11940574 2002 Activation of AXIN2 expression by beta-catenin-T cell factor. A feedback repressor pathway regulating Wnt signaling.
11931652 2002 Promoter characterization of the novel human matrix metalloproteinase-26 gene: regulation by the T-cell factor-4 implies specific expression of the gene in cancer cells of epithelial origin.
11739494 2001 Regulation and possible function of beta-catenin in human monocytes.
11713476 2001 Structure of a human Tcf4-beta-catenin complex.
11713475 2001 Tcf4 can specifically recognize beta-catenin using alternative conformations.
11711551 2002 The transcriptional factor Tcf-4 contains different binding sites for beta-catenin and plakoglobin.
11528255 2001 Genetic alterations in the human Tcf-4 gene in Japanese patients with sporadic gastrointestinal cancers with microsatellite instability.
11504726 2001 Presenilin 1 regulates beta-catenin-mediated transcription in a glycogen synthase kinase-3-independent fashion.
11266540 2001 All Tcf HMG box transcription factors interact with Groucho-related co-repressors.
10937998 2000 Inhibition of adipogenesis by Wnt signaling.
10919662 2000 The human T-cell transcription factor-4 gene: structure, extensive characterization of alternative splicings, and mutational analysis in colorectal cancer cell lines.
10828605 2000 Assignment of the TCF-4 gene (TCF7L2) to human chromosome band 10q25.3.
10694436 2000 Analysis of beta-catenin aggregation and localization using GFP fusion proteins: nuclear import of alpha-catenin by the beta-catenin/Tcf complex.
10080941 1999 Identification of Tcf4 residues involved in high-affinity beta-catenin binding.
9916915 1999 Restricted high level expression of Tcf-4 protein in intestinal and mammary gland epithelium.
9727977 1998 Identification of c-MYC as a target of the APC pathway.
9065402 1997 Activation of beta-catenin-Tcf signaling in colon cancer by mutations in beta-catenin or APC.
9065401 1997 Constitutive transcriptional activation by a beta-catenin-Tcf complex in APC-/- colon carcinoma.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1741298 1992 A gene family of HMG-box transcription factors with homology to TCF-1.