Property Summary

NCBI Gene PubMed Count 165
PubMed Score 320.08
PubTator Score 412.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
breast carcinoma 1638 1.1e-23
malignant mesothelioma 3232 5.4e-09
Pick disease 1894 2.9e-07
juvenile dermatomyositis 1187 2.4e-06
Duchenne muscular dystrophy 601 3.5e-06
ulcerative colitis 1819 3.8e-06
ovarian cancer 8520 7.5e-06
lung adenocarcinoma 2716 8.2e-06
nephrosclerosis 333 6.2e-05
osteosarcoma 7950 1.0e-04
interstitial cystitis 2312 4.4e-04
psoriasis 6694 4.4e-04
glioblastoma 5792 5.5e-04
Chronic Lymphocytic Leukemia 262 6.2e-04
lung cancer 4740 7.0e-04
intraductal papillary-mucinous carcinoma (IPMC) 2989 9.6e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 1.0e-03
invasive ductal carcinoma 2951 1.1e-03
head and neck cancer 271 1.3e-03
acute quadriplegic myopathy 1158 2.4e-03
primary Sjogren syndrome 735 2.8e-03
intraductal papillary-mucinous neoplasm (IPMN) 3291 3.1e-03
atypical teratoid / rhabdoid tumor 5112 3.2e-03
ductal carcinoma in situ 1745 7.9e-03
oligodendroglioma 2850 7.9e-03
pterygium 76 9.3e-03
group 3 medulloblastoma 4104 9.7e-03
pediatric high grade glioma 1064 1.0e-02
Parkinson's disease 392 1.2e-02
primitive neuroectodermal tumor 3035 1.5e-02
dermatomyositis 966 1.7e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 1.8e-02
Rheumatoid arthritis 1191 1.8e-02
gastric carcinoma 807 2.1e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 2.2e-02
Polycystic ovary syndrome 360 2.2e-02
astrocytic glioma 2597 2.4e-02
acute myeloid leukemia 783 2.4e-02
medulloblastoma, large-cell 6241 2.5e-02
pancreatic cancer 2398 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Chromosome 18q deletion syndrome 10 0.0 5.0
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.722 1.9
Disease Target Count Z-score Confidence
Cancer 2499 4.08 2.0
Disease Target Count
Fuchs' endothelial dystrophy 24

Expression

  Differential Expression (40)

Disease log2 FC p
acute myeloid leukemia -1.400 2.4e-02
acute quadriplegic myopathy 1.139 2.4e-03
astrocytic glioma 1.200 2.4e-02
atypical teratoid / rhabdoid tumor -1.500 3.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.148 1.8e-02
breast carcinoma -1.100 1.1e-23
Chronic Lymphocytic Leukemia 2.061 6.2e-04
dermatomyositis 1.500 1.7e-02
Duchenne muscular dystrophy 1.290 3.5e-06
ductal carcinoma in situ -1.100 7.9e-03
gastric carcinoma 1.300 2.1e-02
glioblastoma -1.600 5.5e-04
group 3 medulloblastoma -1.100 9.7e-03
head and neck cancer -1.600 1.3e-03
interstitial cystitis 1.100 4.4e-04
intraductal papillary-mucinous adenoma (... -1.900 1.0e-03
intraductal papillary-mucinous carcinoma... -1.700 9.6e-04
intraductal papillary-mucinous neoplasm ... -2.300 3.1e-03
invasive ductal carcinoma -1.600 1.1e-03
juvenile dermatomyositis 1.021 2.4e-06
lung adenocarcinoma -1.500 8.2e-06
lung cancer 1.100 7.0e-04
malignant mesothelioma -4.700 5.4e-09
medulloblastoma, large-cell -1.200 2.5e-02
nephrosclerosis 1.398 6.2e-05
oligodendroglioma 1.200 7.9e-03
osteosarcoma 1.822 1.0e-04
ovarian cancer -2.200 7.5e-06
pancreatic cancer 1.100 3.3e-02
pancreatic ductal adenocarcinoma liver m... 1.411 2.2e-02
Parkinson's disease -1.700 1.2e-02
pediatric high grade glioma 1.100 1.0e-02
Pick disease 1.200 2.9e-07
Polycystic ovary syndrome 1.036 2.2e-02
primary Sjogren syndrome 1.200 2.8e-03
primitive neuroectodermal tumor 1.100 1.5e-02
psoriasis -1.200 4.4e-04
pterygium 1.100 9.3e-03
Rheumatoid arthritis 1.100 1.8e-02
ulcerative colitis 2.700 3.8e-06

Synonym

Accession P15884 B3KT62 B3KUC0 B4DT37 B4DUG3 B7Z5M6 B7Z6Y1 G0LNT9 G0LNU0 G0LNU1 G0LNU2 G0LNU4 G0LNU5 G0LNU8 G0LNU9 G0LNV0 G0LNV1 G0LNV2 H3BPQ1 Q08AP2 Q08AP3 Q15439 Q15440 Q15441 TCF-4
Symbols E2-2
ITF2
PTHS
SEF2
FECD3
ITF-2
SEF-2
TCF-4
SEF2-1
SEF2-1A
SEF2-1B
SEF2-1D
bHLHb19

Gene

Gene RIF (116)

AA Sequence

MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN      1 - 70
YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS     71 - 140
PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST    141 - 210
FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM    211 - 280
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG    281 - 350
SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG    351 - 420
IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP    421 - 490
QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAE    491 - 560
REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKA    561 - 630
ACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM                                     631 - 667
//

Text Mined References (172)

PMID Year Title