Property Summary

NCBI Gene PubMed Count 7
PubMed Score 244.73
PubTator Score 68.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Polycystic Ovary Syndrome 334
Disease Target Count P-value
ovarian cancer 8491 9.0e-05
breast carcinoma 1614 2.1e-03
fibroadenoma 557 1.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma -2.100 2.1e-03
fibroadenoma -3.000 1.3e-02
ovarian cancer -1.100 9.0e-05

Synonym

Accession Q12870 Q9NQQ1 TCF-15
Symbols EC2
PARAXIS
bHLHa40

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
26428460 Genetic variation in MEOX2, but not TCF15, is a strong predictor of CHD. Further experimental studies should elucidate the underlying molecular mechanisms.
25561514 Microarray profiling on freshly isolated ECs had a genetic signature for microvascular heart ECs and identified Meox2/Tcf15 heterodimers as novel transcriptional determinants. This signature was similar in skeletal muscle and adipose tissue endothelium.
19419955 Activation of TGFbeta recruits p300 to the KLF5-Smad complex to acetylate KLF5, and the complex with acetylated KLF5 binds to the Smad binding element and alters the binding of other factors to p15 promoter to induce its transcription

AA Sequence

MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAGGGGGAGPVVV      1 - 70
VRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPC     71 - 140
FRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRDLGGSCLKVRGVAPLRGPRR               141 - 199
//

Text Mined References (7)

PMID Year Title
26428460 2015 Coronary risk in relation to genetic variation in MEOX2 and TCF15 in a Flemish population.
25561514 2015 Meox2/Tcf15 heterodimers program the heart capillary endothelium for cardiac fatty acid uptake.
19419955 2009 Acetylation of KLF5 alters the assembly of p15 transcription factors in transforming growth factor-beta-mediated induction in epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8825648 1995 Genomic organization and chromosomal localization of the gene TCF15 encoding the early mesodermal basic helix-loop-helix factor bHLH-EC2.
8041747 1994 Cloning and characterization of a basic helix-loop-helix protein expressed in early mesoderm and the developing somites.