Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.39
PubTator Score 4.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.588 3.0e-06
medulloblastoma, large-cell -1.100 9.5e-04
pancreatic ductal adenocarcinoma liver m... -1.576 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-03
pancreatic cancer 1.100 1.2e-04
group 4 medulloblastoma -1.100 4.9e-04
ovarian cancer -2.100 2.7e-09

Synonym

Accession Q8N3R3 A8K9P1 Q0P5T9 Q495R1 Q495R3 Q4G0M4 Q6GMU8
Symbols TOAG1
TOAG-1
C3orf23

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFCHLRPMRRLCLEKIFPHWFPFSRALSGAEAVNALRPFYFAVHPDFFGQHPVEREINENSLKRLSVYLE      1 - 70
NLQKPGFKSLKPTQLTFYVRETDQSSSDGQEPFSTSGFRAVKFTLHTRDLLSTVLYILNSCSLSVEHIQS     71 - 140
LNTNMHTQPLKEAKRMPDRPIKWDKSYYSFTGFKDPDEDLEQVSRVETTLTSWLDNNGKSAVKKLKNSLP    141 - 210
LRKELDRLKDELSHQLQLSDIRWQRSWGIAHRCSQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVG    211 - 280
HVMLGTMDVHHHWTKLFERLPSYFDLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYN    281 - 350
RLLKSRILFHPRSLRGLQMILNSDRYAPSLHELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKV    351 - 420
IENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRLLEQSLPYLHGMHLCISHFYSVMQDGDLCIPWNWK    421 - 490
NGEAIK                                                                    491 - 496
//

Text Mined References (16)

PMID Year Title
23799424 2013 Expansion of memory-type CD8+ T cells correlates with the failure of early immunosuppression withdrawal after cadaver liver transplantation using high-dose ATG induction and rapamycin.
23222918 2013 B-cell-related biomarkers of tolerance are up-regulated in rejection-free kidney transplant recipients.
21804023 2011 Cutting Edge: Immunological consequences and trafficking of human regulatory macrophages administered to renal transplant recipients.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19684086 2009 Expression of tolerance associated gene-1, a mitochondrial protein inhibiting T cell activation, can be used to predict response to immune modulating therapies.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.