Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.85
PubTator Score 4.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (6)

AA Sequence

MAAFLSAGLGILAPSETYPLPTTSSGWEPRLGSPFPSGPCTSSTGAQAVAEPTGQGPKNPRVSRVTVQLE      1 - 70
MKPLWEEFNQLGTEMIVTKAGRRMFPPFQVKILGMDSLADYALLMDFIPLDDKRYRYAFHSSAWLVAGKA     71 - 140
DPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVFVDPRKDSERY    141 - 210
AQENFKSFIFTETQFTAVTAYQNHRITQLKIASNPFAKGFRESDLDSWPVAPRPLLSVPARSHSSLSPCV    211 - 280
LKGATDREKDPNKASASTSKTPAWLHHQLLPPPEVLLAPATYRPVTYQSLYSGAPSHLGIPRTRPAPYPL    281 - 350
PNIRADRDQGGLPLPAGLGLLSPTVVCLGPGQDSQ                                       351 - 385
//

Text Mined References (12)

PMID Year Title