Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.77
PubTator Score 27.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 5.6e-04
group 4 medulloblastoma 1.200 2.8e-04
ovarian cancer 1.700 1.1e-06

Synonym

Accession Q15814 Q53Y43 Q5T787
Symbols CFC

Gene

PANTHER Protein Class (1)

PDB

2L3L   2YUH  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (3)

PMID Text
22028797 a testable model for TBCC N-terminal domain/tubulin recognition in which the highly charged N-terminus as well as residues from the three helices and the loops interact with the acidic hypervariable regions of tubulin monomers
20384997 Microtubule dynamicity was reduced in breast cancer cells overexpressing TBCC. Cell cycle distribution was altered in cells containing larger amounts of TBCC. TBCC had little effect on cell proliferation.
11847227 functional overlap with retinitis pigmenosa 2 protein

AA Sequence

MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAA      1 - 70
VEELLERAESVERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFK     71 - 140
TRGKDAASSTKVDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASELHQRDVLLTE    141 - 210
LSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI    211 - 280
VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD        281 - 346
//

Text Mined References (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22100072 2011 Recessive mutations in ELOVL4 cause ichthyosis, intellectual disability, and spastic quadriplegia.
22028797 2011 The solution structure of the N-terminal domain of human tubulin binding cofactor C reveals a platform for tubulin interaction.
21269460 2011 Initial characterization of the human central proteome.
20384997 2010 Tubulin binding cofactor C (TBCC) suppresses tumor growth and enhances chemosensitivity in human breast cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417528 2002 Localization in the human retina of the X-linked retinitis pigmentosa protein RP2, its homologue cofactor C and the RP2 interacting protein Arl3.
11847227 2002 Functional overlap between retinitis pigmentosa 2 protein and the tubulin-specific chaperone cofactor C.
8706133 1996 Pathway leading to correctly folded beta-tubulin.
8567715 1996 Chaperonin-mediated folding of actin and tubulin.