Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.04
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -1.818 1.3e-02
adult high grade glioma -1.900 9.8e-05
astrocytic glioma -1.800 3.2e-03
Astrocytoma, Pilocytic -1.500 4.3e-07
atypical teratoid / rhabdoid tumor -1.700 6.5e-05
Breast cancer -2.300 2.3e-05
Duchenne muscular dystrophy 1.173 2.8e-06
ependymoma -1.800 6.3e-03
glioblastoma -1.700 1.4e-06
group 4 medulloblastoma 1.600 1.7e-04
intraductal papillary-mucinous carcinoma... -2.500 2.9e-02
juvenile dermatomyositis 1.087 2.9e-10
lung adenocarcinoma -1.200 3.8e-08
lung cancer -3.500 7.8e-06
lung carcinoma -1.600 3.2e-35
malignant mesothelioma -1.200 5.8e-06
mucosa-associated lymphoid tissue lympho... 2.085 2.1e-02
oligodendroglioma -1.400 1.6e-02
osteosarcoma 1.012 4.9e-04
ovarian cancer -3.100 9.3e-10
Parkinson's disease -1.300 2.6e-02
Pick disease -1.100 1.9e-02
primary Sjogren syndrome 2.100 3.0e-04
psoriasis 1.400 2.6e-02
subependymal giant cell astrocytoma -1.527 1.4e-02

Gene RIF (5)

AA Sequence

MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTP      1 - 70
DSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQGIIAEYNKINDVKEDDDTEK     71 - 140
FKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMYLSINHLCFYSFLMGREAKLVIRWVDITQLE    141 - 210
KNATLLLPDVIKVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRKSPKKVS    211 - 280
ALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIP    281 - 350
LREVTIVEKADSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSD    351 - 420
DEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLAKEFLKEQAWK    421 - 490
IHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPGYYEDLVEKSMGKYNLATEEI    491 - 560
ERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERM    561 - 630
LPDYYNTRVVGALVDQGVFEELARDYVPQLYDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFY    631 - 700
EGIKVIFQLALAVLDANVDKLLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDI    701 - 770
FRLIRTSYEKFGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLT    771 - 840
SCYWGGSSNALDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDENGDSLINFRE    841 - 910
FVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDITPECTHVVGLDSRSKQGADD    911 - 980
GFVTVSLKPDKGKRANSQENRNYLRLWTPENKSKSKNAKDLPKLNQGQFIELCKTMYNMFSEDPNEQELY    981 - 1050
HATAAVTSLLLEIGEVGKLFVAQPAKEGGSGGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPD   1051 - 1120
SEEHSLGGQMEDIKLEDSSPRDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDIGEDTVLV   1121 - 1190
RSGQGTAALPRSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARITSAKNIRMMGKPLTSASDYE   1191 - 1260
ISAMSG                                                                   1261 - 1266
//

Text Mined References (18)

PMID Year Title