Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.90
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -1.200 5.8e-06
astrocytic glioma -1.800 3.2e-03
ependymoma -1.800 6.3e-03
oligodendroglioma -1.400 1.6e-02
psoriasis 1.400 2.6e-02
glioblastoma -2.200 1.7e-04
osteosarcoma 1.012 4.9e-04
atypical teratoid / rhabdoid tumor -1.700 6.5e-05
Duchenne muscular dystrophy 1.173 2.8e-06
juvenile dermatomyositis 1.087 2.9e-10
intraductal papillary-mucinous carcinoma... -2.500 2.9e-02
lung cancer -3.500 7.8e-06
active ulcerative colitis -1.818 1.3e-02
Parkinson's disease -1.300 2.6e-02
adult high grade glioma -1.900 9.8e-05
group 4 medulloblastoma 1.600 1.7e-04
pilocytic astrocytoma -1.500 3.9e-07
primary Sjogren syndrome 2.100 3.0e-04
subependymal giant cell astrocytoma -1.527 1.4e-02
lung adenocarcinoma -1.200 3.8e-08
lung carcinoma -1.600 3.2e-35
Pick disease -1.100 1.9e-02
mucosa-associated lymphoid tissue lympho... 2.085 2.1e-02
ovarian cancer -3.100 9.3e-10
Breast cancer -2.300 2.3e-05

Synonym

Accession Q6ZT07 A6H8U8 D3DNZ1 O94958
Symbols MDR1
GRAMD9

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
25542144 This study concluded that diindolylmethane induces pregnane X receptor -regulated CYP3A4 and MDR1 gene expression.
22296392 The MDR1 gene CT/TT genotype of C3435T was significantly associated with a shorter progression-free survival (PFS) and overall survival (OS).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18228020 CD34+ leukemic subpopulation predominantly displays lower spontaneous apoptosis and has higher expression levels of MDR19TBC1 domain family member 9 (with GRAM domain) ) genes than CD34- cells in childhood AML
16355344 Plasma levels of atazanavir were significantly higher in patients with MDR1 genotype CC than in those with CT or TT, and bilirubin levels correlated with atazanavir concentrations.

AA Sequence

MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTP      1 - 70
DSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQGIIAEYNKINDVKEDDDTEK     71 - 140
FKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMYLSINHLCFYSFLMGREAKLVIRWVDITQLE    141 - 210
KNATLLLPDVIKVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRKSPKKVS    211 - 280
ALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIP    281 - 350
LREVTIVEKADSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSD    351 - 420
DEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLAKEFLKEQAWK    421 - 490
IHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPGYYEDLVEKSMGKYNLATEEI    491 - 560
ERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERM    561 - 630
LPDYYNTRVVGALVDQGVFEELARDYVPQLYDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFY    631 - 700
EGIKVIFQLALAVLDANVDKLLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDI    701 - 770
FRLIRTSYEKFGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLT    771 - 840
SCYWGGSSNALDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDENGDSLINFRE    841 - 910
FVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDITPECTHVVGLDSRSKQGADD    911 - 980
GFVTVSLKPDKGKRANSQENRNYLRLWTPENKSKSKNAKDLPKLNQGQFIELCKTMYNMFSEDPNEQELY    981 - 1050
HATAAVTSLLLEIGEVGKLFVAQPAKEGGSGGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPD   1051 - 1120
SEEHSLGGQMEDIKLEDSSPRDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDIGEDTVLV   1121 - 1190
RSGQGTAALPRSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARITSAKNIRMMGKPLTSASDYE   1191 - 1260
ISAMSG                                                                   1261 - 1266
//

Text Mined References (18)

PMID Year Title
25542144 2015 Diindolylmethane, a naturally occurring compound, induces CYP3A4 and MDR1 gene expression by activating human PXR.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
22296392 2011 MDR1 gene C3435T polymorphism is associated with clinical outcomes in gastric cancer patients treated with postoperative adjuvant chemotherapy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18228020 2008 CD34+ leukemic subpopulation predominantly displays lower spontaneous apoptosis and has higher expression levels of Bcl-2 and MDR1 genes than CD34- cells in childhood AML.
16355344 2006 Plasma levels of atazanavir and the risk of hyperbilirubinemia are predicted by the 3435C-->T polymorphism at the multidrug resistance gene 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12970790 2003 High level of cannabinoid receptor 1, absence of regulator of G protein signalling 13 and differential expression of Cyclin D1 in mantle cell lymphoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.