Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.44
PubTator Score 7.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 7.4e-16
osteosarcoma 7950 3.7e-06
lung adenocarcinoma 2716 1.1e-03
interstitial cystitis 2312 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 1.800 1.8e-03
lung adenocarcinoma -1.100 1.1e-03
non-small cell lung cancer -1.376 7.4e-16
osteosarcoma -2.860 3.7e-06

Synonym

Accession Q8IV04 G3V1D6
Symbols EPI64C
CARABIN

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM      1 - 70
TSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLH     71 - 140
RQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPG    141 - 210
YYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEG    211 - 280
ARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQL    281 - 350
AQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLL    351 - 420
TRARGPPIEGPPRPQRGSTSFLDTRF                                                421 - 446
//

Text Mined References (14)

PMID Year Title