Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.31
PubTator Score 3.10

Knowledge Summary

Patent (2,710)

AA Sequence

MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILV      1 - 70
LYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVL     71 - 140
SVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRR    141 - 210
HIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSS    211 - 280
HSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI                                    281 - 318
//

Text Mined References (12)

PMID Year Title