1. Home
  2. Targets
  3. cytoskeletal protein
  4. actin family cytoskeletal protein
  5. non-motor actin binding protein
  6. Transgelin

Tbio Transgelin

Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. [provided by RefSeq, Aug 2017]

 Comments

Property Summary

NCBI Gene PubMed Count 80
PubMed Score 384.66
PubTator Score 187.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.271 2.1
Atherosclerosis 291 3.444 1.7
Hypertension 396 3.103 1.6

Expression

  Differential Expression (32)

Disease log2 FC p
Endometriosis -1.339 3.1e-02
acute quadriplegic myopathy 1.282 5.0e-04
adrenocortical carcinoma -2.168 1.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.163 2.1e-02
Becker muscular dystrophy 1.383 8.3e-03
Breast cancer -1.900 1.2e-28
breast carcinoma -1.200 6.0e-10
colon cancer -3.700 6.1e-04
cystic fibrosis -1.034 1.9e-04
diabetes mellitus -1.100 4.9e-02
Duchenne muscular dystrophy 1.021 1.6e-03
glioblastoma 3.500 1.5e-02
group 4 medulloblastoma -1.600 1.6e-03
intraductal papillary-mucinous adenoma (... -1.800 1.5e-05
intraductal papillary-mucinous carcinoma... -2.000 3.1e-05
intraductal papillary-mucinous neoplasm ... -2.000 4.8e-04
invasive ductal carcinoma -1.300 2.6e-02
limb girdle muscular dystrophy 2A 1.171 4.2e-03
lung carcinoma -1.100 2.4e-07
malignant mesothelioma -1.100 1.1e-05
nephrosclerosis 1.168 9.9e-03
ovarian cancer -1.300 4.6e-02
pancreatic cancer 4.100 4.0e-05
periodontitis 1.200 5.0e-18
Pick disease 1.300 3.7e-02
pituitary cancer -1.300 1.6e-02
posterior fossa group A ependymoma 1.500 8.5e-05
primary pancreatic ductal adenocarcinoma 4.067 4.5e-06
psoriasis -1.300 3.3e-03
pterygium 1.800 4.2e-03
spina bifida -1.720 3.9e-02
urothelial carcinoma 2.800 3.8e-02

Synonym

Accession Q01995 O15542
Symbols SM22
SMCC
TAGLN1
WS3-10
SM22-alpha

Gene

TAGLN

PANTHER Protein Class (3)

  Ortholog (13)

Species Source Disease
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA

 UniProt Keyword (9)

 GO Function (1)

 GO Component (1)

 GO Process (2)

 Compartment GO Term (31)

See all...

 MGI Phenotype (13)

See all...

 GWAS Trait (3)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

Gene RIF (57)

AA Sequence 

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY      1 - 70
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK     71 - 140
NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS             141 - 201
//

Text Mined References (85)

PMID Year Title