Property Summary

NCBI Gene PubMed Count 23
PubMed Score 0.22
PubTator Score 15.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.200 3.6e-05
astrocytic glioma -2.200 1.8e-03
Astrocytoma, Pilocytic -1.900 9.4e-06
Breast cancer -1.500 3.3e-04
cystic fibrosis 1.759 9.3e-06
ependymoma -2.000 5.9e-03
glioblastoma -1.400 8.4e-04
group 4 medulloblastoma -2.800 5.8e-06
invasive ductal carcinoma -1.246 1.3e-02
lung cancer 1.800 2.3e-02
lung carcinoma -1.200 1.9e-20
nasopharyngeal carcinoma 1.100 6.3e-04
oligodendroglioma -2.000 3.3e-03
osteosarcoma 1.205 5.0e-04
pituitary cancer -1.100 1.7e-04
primitive neuroectodermal tumor -1.900 1.9e-04
psoriasis -1.100 9.0e-04

Gene RIF (18)

AA Sequence

MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQPLRSPVGTLV      1 - 70
TKVAPVSAPPKVSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIKSNSGPLMLVSPQQTVTRAET     71 - 140
TSNITSRPAVPANPQTVKICTVPNSSSQLIKKVAVTPVKKLAQIGTTVVTTVPKPSSVQSVAVPTSVVTV    141 - 210
TPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSP    211 - 280
EMGQNVKKLVEQLLDAKIEAEEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSS    281 - 350
DMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAA    351 - 420
TGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAICLPSVKPVVSS    421 - 490
AGTTSDKPVIGTPVQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNEKQVTTISHSSTLTIQKCGQK    491 - 560
TMPVNTIIPTSQFPPASILKQITLPGNKILSLQASPTQKNRIKENVTSCFRDEDDINDVTSMAGVNLNEE    561 - 630
NACILATNSELVGTLIQSCKDEPFLFIGALQKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLT    631 - 700
AIAQHRMTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKA    701 - 770
KELQQLELAQIQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDL    771 - 840
IFCMEQEREMKYSRALYLALLK                                                    841 - 862
//

Text Mined References (25)

PMID Year Title