Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.89
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.410 1.1e-02
osteosarcoma 1.013 6.9e-03
astrocytoma -1.100 2.4e-02
juvenile dermatomyositis 2.020 1.6e-13
acute quadriplegic myopathy 1.401 2.5e-04
pancreatic ductal adenocarcinoma liver m... 1.918 6.1e-04
lung cancer 1.300 6.4e-04
colon cancer 1.100 5.2e-06
group 4 medulloblastoma -1.500 4.2e-03
spina bifida -2.048 4.1e-02
Pick disease -1.200 8.1e-06
ovarian cancer 3.200 3.3e-07

Synonym

Accession Q9H5J8 Q6I9Y6
Symbols JOSD3
RAFI41
TAFI41
TAF(I)41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

PMID Text
17318177 TAF(I)41 (MGC5306) is integral to transcriptionally active SL1 and plays a role in Pol I recruitment and, therefore, preinitiation complex formation in vivo.
15520167 An antigrowth activity and modulations of cell cycle events are identified in cells expressing siRNAMGC5306.

AA Sequence

MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSF      1 - 70
EPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESEN     71 - 140
EKNAPWRKILTFEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEE    141 - 210
STAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM      211 - 278
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
15520167 2004 A novel nuclear protein, MGC5306 interacts with DNA polymerase beta and has a potential role in cellular phenotype.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.