Property Summary

NCBI Gene PubMed Count 25
PubMed Score 6.78
PubTator Score 13.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 416 5.3e-07
psoriasis 6694 5.2e-05
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.548 1.8
Orchitis 28 3.156 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.100 5.3e-07
psoriasis -1.600 5.2e-05

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTERYQEVTNTDLIPNTQIKALNRGLKKKNNTEK      1 - 70
GWDWYVCEGFQYILYQQAEALKNLGVGPELKNDVLHNFWKRYLQKSKQAYCKNPVYTTGRKPTVLEDNLS     71 - 140
HSDWASEPELLSDVSCPPFLESGAESQSDIHTRKPFPVSKASQSETSVCSGSLDGVEYSQRKEKGIVKMT    141 - 210
MPQTLAFCYLSLLWQREAITLSDLLRFVEEDHIPYINAFQHFPEQMKLYGRDRGIFGIESWPDYEDIYKK    211 - 280
TVEVGTFLDLPRFPDITEDCYLHPNILCMKYLMEVNLPDEMHSLTCHVVKMTGMGEVDFLTFDPIAKMAK    281 - 350
TVKYDVQAVAIIVVVLKLLFLLDDSFEWSLSNLAEKHNEKNKKDKPWFDFRKWYQIMKKAFDEKKQKWEE    351 - 420
ARAKYLWKSEKPLYYSFVDKPVAYKKREMVVNLQKQFSTLVESTATAGKKSPSSFQFNWTEEDTDRTCFH    421 - 490
GHSLQGVLKEKGQSLLTKNSLYWLSTQKFCRCYCTHVTTYEESNYSLSYQFILNLFSFLLRIKTSLLHEE    491 - 560
VSLVEKKLFEKKYSVKRKKSRSKKVRRH                                              561 - 588
//

Text Mined References (31)

PMID Year Title