Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.49
PubTator Score 46.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 4.2e-02
subependymal giant cell astrocytoma -1.546 4.7e-02

Gene RIF (3)

AA Sequence

MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRC      1 - 70
QILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCS     71 - 140
HTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGS    141 - 210
NVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDL    211 - 280
FEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC                   281 - 335
//

Text Mined References (10)

PMID Year Title