Property Summary

NCBI Gene PubMed Count 86
PubMed Score 684.31
PubTator Score 296.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
osteosarcoma -4.586 5.3e-07
cystic fibrosis 4.154 2.2e-08
tuberculosis -1.200 4.2e-02
pancreatic ductal adenocarcinoma liver m... 5.171 9.3e-04
intraductal papillary-mucinous carcinoma... 1.600 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.1e-03
lung cancer -1.700 2.1e-05
active Crohn's disease 1.749 2.7e-02
active ulcerative colitis 2.547 3.8e-03
pancreatic cancer 2.100 2.1e-05
interstitial cystitis -3.000 2.8e-04
nasopharyngeal carcinoma -2.300 1.3e-03
pulmonary arterial hypertension -2.300 4.5e-02
lung carcinoma -3.900 3.9e-41
spina bifida -1.484 3.6e-02
mucosa-associated lymphoid tissue lympho... 1.034 3.6e-02
ductal carcinoma in situ 2.900 2.3e-02
ovarian cancer 4.200 3.0e-05

 GO Function (1)

Gene RIF (68)

PMID Text
26773504 Altogether, our data suggest that TROP2 plays an important role in promoting ADC and may represent a novel prognostic biomarker and therapeutic target for the disease.
26626643 TROP2 is epigenetically down-regulated and operates as a negative regulator of cell proliferation and migration in liver fluke-associated cholangiocarcinoma.
26617817 overexpression of TROP2 appears to be an independent predictor for poor clinical outcome in nasopharyngeal carcinoma
26600538 Lower GA733-2 expression in cancer tissues appeared to correlate with lymph node metastases (P < 0.05). GA733-1 gene expression was significantly higher in cancerous samples
26481593 TROP-2 is specifically expressed in papillary thyroid carcinoma.
26115884 The amino acid exchange resulting from 4461T[C does not appear to alter binding of HO-3, suggesting that treatment with catumaxomab can be offered to patients regardless of their TACSTD1-genotype.
26101915 Trop-2 is a novel target for ADC therapy because of its high expression by many solid cancers.
26059528 TROP2 protein is expressed at high levels in the colon cancer tissues.
25779928 These observations suggest that Trop2 serves an oncogenic role in LSCC and has potential as a therapeutic target
25550831 This study reveals that both EpCAM and Trop2 overexpression in pituitary adenomas correlate significantly with invasiveness and proliferation. Follow-up analysis shows that Trop2 is a predictive factor for recurrence/progression for PAs.
25523132 studies have begun to identify the mechanisms underlying TROP2's functions, including regulated intramembrane proteolysis or specific interactions with integrin b1 and claudin proteins.
25238142 Trop2 loss triggers sensitivity to anti-ErbB3 antibodies, which results in reduced proliferation and tumorigenic growth of Trop2 negative head and neck squamous cell cancer cells.
25164548 TROP-2 can be used as well as HBME-1 in thyroid cytology to detect PTC.
24824621 we demonstrate that the Trop-2 activation states are critical determinants of tumor progression and are powerful indicators of breast cancer patients survival.
24816726 Trop2 is important in proliferation and apoptosis regulation in CaSki cells, which may become a novel target for cervical cancer treatment.
24764155 TACSTD2 protein, human is predicting lymph node metastases in OSCC, overall survival and disease-free survival.
24651436 Inhibition of Tacstd2 expression significantly inhibited chemotherapeutic reagent-induced apoptosis, and TACSTD2 regulated apoptotic gene expression through P63 containing the transactivation domain (TAp63).
24086649 Overexpression of TROP2 predicts poor prognosis of patients with cervical cancer and promotes the proliferation and invasion of cervical cancer cells by regulating ERK signaling pathway.
23979406 Trop2 expression reflects a more malignant phenotype and may serve as an unfavorable prognostic factor for extranodal NK/T cell lymphoma, nasal type
23872121 Used the Sf9 cells to express the Trop2 ectodomain (Trop2EC) in two forms - wt glycosylated (gTrop2EC) and mutant non-glycosylated form (Trop2EC(Delta/N)). Recombinant protein was purified and structure studied.
23868985 The cells exhibited a low epithelial barrier function as well as decreased expression of tight-junction-related proteins claudin 1 and 7.
23536555 show that Trop-2 enhances directional prostate cancer cell migration, through modulation of Rac1 GTPase activity
23416980 miR-125b-1 causes mitogen-activated protein kinase pathway dysfunction through regulation of TACSTD2 expression.
23397225 The results of this study suggested that the TROP2 correlated with malignancy, proliferation and angiogenesis in human gliomas
23055188 High expression of TROP2 was associated with stage stage IIb colon cancer.
23038033 More than 90% of Gelatinous drop-like corneal dystrophy (GDLD) patients possessed the same haplotype with a Q118X mutation in TACSTD2.
23031786 study characterized the expression of TACSTD2 in invasive ductal breast cancer(IDC) and adjacent non-malignant tissues; studies demonstrated that the high expression of TACSTD2 correlates with a poor prognosis in IDC
22987366 TROP2 gene expression can be used as an independent prognostic indicator for squamous cell carcinoma of the larynx.
22562244 Network hubs and interacting partners are co-expressed with Trop-2 in primary human tumours, supporting a role of this signalling network in cancer growth.
22419550 Inactivation of TROP2 due to loss of heterozygosity or by DNA methylation may play an important role in lung cancer tumourigenicity through losing its suppressive effect on IGF-1R signalling and tumour growth.
22378065 our data demonstrate that the transmembrane receptor Trop-2 is a regulator of PrCa cell adhesion to fibronectin through activation of the beta(1) integrin-RACK1-FAK-Src signaling axis
22349828 Our data support a model where above-baseline expression of wild-type Trop-2 is a key driver of human cancer growth.
22190649 TACSTD2 expression was inversely correlated with methylation (P=0.016), and both measures were associated with fat mass (expression, P=0.049; methylation, P=0.037)
22075385 Trop-2 is overexpressed in a proportion of human uterine (UMMT) and ovarian (OMMT) carcinosarcoma.
21677668 TROP2 (TACSTD2), an EpCAM-like molecule, is a specific marker for TGF-beta1-dependent human epidermal Langerhans cells
21551320 In human and mouse, Trop2 is highly expressed at both the transcript and protein levels on several essential normal tissues.
21541270 Two novel mutations of TACSTD2 are found in three Japanese gelatinous drop-like corneal dystrophy families with their aberrant subcellular localization.
21418992 The expression of Trop-2 is correlated with the development and malignancy of pancreatic cancer.
21246534 Trop-2 was highly expressed in uterine serous carcinoma at mRNA and protein levels
21052915 Genetic analysis revealed that all the patients possessed a homozygous Q118X mutation in TACSTD2, a major founder mutation in Japanese gelatinous drop-like corneal dystrophy.
20858281 Study also provides the first indication of a molecular signaling pathway activated by Trop2 which has important implications for cancer cell growth and survival.
20651236 loss of function of the TACSTD2 gene impairs epithelial barrier function through decreased expression and altered subcellular localization of tight junction-related proteins in Gelatinous drop-like dystrophy corneas
20473768 TROP2 overexpression and lymph node metastasis were independent prognostic markers in pulmonary adenocarcinoma
20454699 Novel TACSTD2 C119Y mutation leading to amino acid substitution was identified in two affected siblings. Protein modeling studies revealed an exposed cysteine residue.
20060709 Trop-2 protein overexpression correlates with an aggressive malignant phenotype and may constitute a novel prognostic factor for epithelial ovarian cancer
19693293 The newly identified mutation expands the spectrum of mutations in TACSTD2 that may cause pathological corneal amyloidosis.
19434540 TROP2 is a differentially expressed gene between left-sided and right-sided colon cancer, and high expression is closely related to factors indicating poor prognosis.
19421758 Elevated expressions of MMP7, TROP2, and survivin are associated with survival, disease recurrence, and liver metastasis of colon cancer.
19088204 Trop2 identifies a subpopulation of murine and human prostate basal cells with stem cell characteristics.(
18829570 The chimeric mRNA is a bicistronic transcript of post transcriptional origin that independently translates the Cyclin D1 and Trop-2 proteins in cancer cells.
18813308 TROP2 could be a novel prognostic biomarker for pancreatic cancer.
18281513 Trop-2 is an oncogene that has potential as a therapeutic target in colon cancer.
18084248 TROP2 overexpression is an independent prognostic marker in patients with oral squamous cell carcinoma.
17898270 Although mutations in TACSTD2 among Iranian patients with GDLD were heterogeneous, E227K was found to be a common mutation. It is suggested that E227K may be a founder mutation in this population
17878632 Detection of GA733 mRNA by qualitative RT-PCR is highly specific for diagnosis of malignant pleural and peritoneal effusions.
17768381 It is concluded that Gelatinous Drop-like Corneal Dystrophy (GDLD) in the pedigree is probably not caused by mutations in TACSTD2, supporting evidence for the existence of at least one other locus for GDLD.
17721311 This is the first report, to our knowledge, of a homozygous mutation (L186P) in the M1S1 gene found in a Turkish patient.
17653040 study reports two novel mutations in two gelatinous drop-like corneal dystrophy families and expands the spectrum of mutations in TACSTD2 gene that may cause pathological corneal amyloidosis
17167402 Newly identified mutation is predicted to generate shortened protein product, thereby completely altering COOH-terminal region and deleting transmembrane domain, required for anchoring at cell membranes and phosphatidylinosyol2-binding site.
16707602 TROP2 mRNA and protein were overexpressed in colorectal cancer cells, and high TROP2 expression status correlated with liver metastasis and poor prognosis
16232198 abnormal transcription of TACSTD2 and S100A2 are thought to be unique molecular markers of the preinvasive stage of lung adenocarcinoma
15652848 The results confirm that the missense mutation L186P in the TACSTD2 gene is also responsible for the GDLD (gelatinous droplike dystrophy) phenotype.
15295654 The affected members had compound heterozygous mutations consisting of a nonsense change at codon 84 (K84X) and a missense mutation resulting in a substitution of arginine for cysteine at codon 108 (C108R).
15013888 Because the compound heterozygote mutations Q118X and Y184C cosegregated with the phenotype, they are likely the cause of GDLD (gelatinous droplike corneal dystrophy) in this patient.
12614764 A novel mutation of M1S1 gene found in a Vietnamese patient with gelatinous droplike corneal dystrophy.
12107443 Allelic and locus heterogeneity in autosomal recessive gelatinous drop-like corneal dystrophy. Seven novel mutations (M1R, 8-bp ins., Q118 E, V194 E, C119 S, 870delC, and 1117delA) were identified in six families and two unrelated individuals.
12036680 The Q118X mutation of the M1S1 gene can produce either a gelatinous drop-like region or band-shaped opacities.
9462726 Discusses cloning of mouse Trop2 and comparison to the human homolog.

AA Sequence

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT      1 - 70
SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD     71 - 140
LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS    141 - 210
QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV    211 - 280
IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL                               281 - 323
//

Text Mined References (88)

PMID Year Title
26773504 2016 TROP2 overexpression promotes proliferation and invasion of lung adenocarcinoma cells.
26626643 Suppression of trophoblast cell surface antigen 2 enhances proliferation and migration in liver fluke-associated cholangiocarcinoma.
26617817 2015 Prognostic value of TROP2 in human nasopharyngeal carcinoma.
26600538 2015 Expression profile of the GA733 gene family in colorectal cancer: correlation with clinicopathological parameters.
26481593 2016 TROP-2 expression in papillary thyroid carcinoma: Potential Diagnostic Utility.
26115884 2015 Single nucleotide polymorphisms of the EpCAM-coding gene TACSTD1 in patients with ovarian cancer and their potential translational aspects.
26101915 2015 Trop-2 is a novel target for solid cancer therapy with sacituzumab govitecan (IMMU-132), an antibody-drug conjugate (ADC).
26059528 2015 Clinical investigation of TROP-2 as an independent biomarker and potential therapeutic target in colon cancer.
25779928 2015 Trop2 inhibition suppresses the proliferation and invasion of laryngeal carcinoma cells via the extracellular signal-regulated kinase/mitogen-activated protein kinase pathway.
25550831 2014 Overexpression of EpCAM and Trop2 in pituitary adenomas.
25523132 2015 Trop2: from development to disease.
25238142 2014 Loss of Trop2 causes ErbB3 activation through a neuregulin-1-dependent mechanism in the mesenchymal subtype of HNSCC.
25164548 2015 TROP-2 expression in papillary thyroid cancer: a preliminary cyto-histological study.
24824621 2014 Trop-2 is a determinant of breast cancer survival.
24816726 2014 Trop2 gene: a novel target for cervical cancer treatment.
24764155 2015 Nodal metastasis and survival in oral cancer: Association with protein expression of SLPI, not with LCN2, TACSTD2, or THBS2.
24651436 2014 Loss of TACSTD2 contributed to squamous cell carcinoma progression through attenuating TAp63-dependent apoptosis.
24086649 2013 Overexpression of TROP2 predicts poor prognosis of patients with cervical cancer and promotes the proliferation and invasion of cervical cancer cells by regulating ERK signaling pathway.
23979406 2013 Increased expression of Trop2 correlates with poor survival in extranodal NK/T cell lymphoma, nasal type.
23872121 2013 Biochemical and preliminary X-ray characterization of the tumor-associated calcium signal transducer 2 (Trop2) ectodomain.
23868985 2013 Establishment of a human corneal epithelial cell line lacking the functional TACSTD2 gene as an in vitro model for gelatinous drop-like dystrophy.
23536555 2013 Trop-2 promotes prostate cancer metastasis by modulating ?(1) integrin functions.
23416980 2014 Loss of miR-125b-1 contributes to head and neck cancer development by dysregulating TACSTD2 and MAPK pathway.
23397225 2013 TROP2 expression and its correlation with tumor proliferation and angiogenesis in human gliomas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23055188 2012 Different effects of ER? and TROP2 expression in Chinese patients with early-stage colon cancer.
23038033 2012 Gelatinous drop-like corneal dystrophy.
23031786 2013 Significantly upregulated TACSTD2 and Cyclin D1 correlate with poor prognosis of invasive ductal breast cancer.
22987366 2013 Potential therapeutic target and independent prognostic marker of TROP2 in laryngeal squamous cell carcinoma.
22562244 2013 The Trop-2 signalling network in cancer growth.
22419550 2012 TROP2 is epigenetically inactivated and modulates IGF-1R signalling in lung adenocarcinoma.
22378065 2012 Trop-2 inhibits prostate cancer cell adhesion to fibronectin through the ?1 integrin-RACK1 axis.
22349828 2013 Upregulation of Trop-2 quantitatively stimulates human cancer growth.
22190649 2012 Postnatal growth and DNA methylation are associated with differential gene expression of the TACSTD2 gene and childhood fat mass.
22075385 2011 Uterine and ovarian carcinosarcomas overexpressing Trop-2 are sensitive to hRS7, a humanized anti-Trop-2 antibody.
21677668 2011 Identification of TROP2 (TACSTD2), an EpCAM-like molecule, as a specific marker for TGF-?1-dependent human epidermal Langerhans cells.
21551320 2011 Expression of Trop2 cell surface glycoprotein in normal and tumor tissues: potential implications as a cancer therapeutic target.
21541270 2011 Two novel mutations of TACSTD2 found in three Japanese gelatinous drop-like corneal dystrophy families with their aberrant subcellular localization.
21418992 2011 [Expression and clinical significance of Trop-2 in human pancreatic cancer].
21269460 2011 Initial characterization of the human central proteome.
21246534 2011 Uterine serous papillary carcinomas overexpress human trophoblast-cell-surface marker (Trop-2) and are highly sensitive to immunotherapy with hRS7, a humanized anti-Trop-2 monoclonal antibody.
21052915 2010 Chromosomal sharing in atypical cases of gelatinous drop-like corneal dystrophy.
20858281 2010 Trop2 expression contributes to tumor pathogenesis by activating the ERK MAPK pathway.
20651236 2010 Tumor-associated calcium signal transducer 2 is required for the proper subcellular localization of claudin 1 and 7: implications in the pathogenesis of gelatinous drop-like corneal dystrophy.
20473768 2010 Expression of the GA733 gene family and its relationship to prognosis in pulmonary adenocarcinoma.
20454699 2010 Identification and characterization of a novel TACSTD2 mutation in gelatinous drop-like corneal dystrophy.
20060709 2010 Trop-2 overexpression as an independent marker for poor overall survival in ovarian carcinoma patients.
19693293 2009 A novel TACSTD2 mutation identified in two Chinese brothers with gelatinous drop-like corneal dystrophy.
19434540 2009 [Expression of TROP2 mRNA in left-sided and right-sided colon cancer and its clinical significance].
19421758 2009 Elevated expressions of MMP7, TROP2, and survivin are associated with survival, disease recurrence, and liver metastasis of colon cancer.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19088204 2008 Trop2 identifies a subpopulation of murine and human prostate basal cells with stem cell characteristics.
18829570 2008 A bicistronic CYCLIN D1-TROP2 mRNA chimera demonstrates a novel oncogenic mechanism in human cancer.
18813308 2008 High expression of TROP2 correlates with poor prognosis in pancreatic cancer.
18281513 2008 Identification of Trop-2 as an oncogene and an attractive therapeutic target in colon cancers.
18084248 2008 TROP2: a novel prognostic marker in squamous cell carcinoma of the oral cavity.
17898270 2007 Four mutations (three novel, one founder) in TACSTD2 among Iranian GDLD patients.
17878632 2007 Detection of mRNAs of GA733 genes by RT-PCR in exfoliated cells of pleural and peritoneal effusions and its clinical values.
17768381 2007 Exclusion of TACSTD2 in an Iranian GDLD pedigree.
17721311 2007 A missense mutation in the M1S1 gene found in a turkish patient with gelatinous droplike corneal dystrophy.
17653040 2007 Two novel mutations identified in two Chinese gelatinous drop-like corneal dystrophy families.
17167402 2006 A novel TACSTD2 gene mutation in a Turkish family with a gelatinous drop-like corneal dystrophy.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16707602 2006 Clinical significance of TROP2 expression in colorectal cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16232198 2005 Establishment of an immortalized cell line from a precancerous lesion of lung adenocarcinoma, and genes highly expressed in the early stages of lung adenocarcinoma development.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15652848 2005 A novel missense mutation in a Japanese patient with gelatinous droplike corneal dystrophy.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15295654 Mutations in the membrane component, chromosome 1, surface marker 1 (M1S1) gene in gelatinous drop-like corneal dystrophy.
15013888 2004 Compound heterozygous mutations of M1S1 gene in gelatinous droplike corneal dystrophy.
12614764 2003 A novel mutation of M1S1 gene found in a Vietnamese patient with gelatinous droplike corneal dystrophy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11687514 2001 A novel mutation in the M1S1 gene responsible for gelatinous droplike corneal dystrophy.
11306819 2001 Assignment of TACSTD1 (alias TROP1, M4S1) to human chromosome 2p21 and refinement of mapping of TACSTD2 (alias TROP2, M1S1) to human chromosome 1p32 by in situ hybridization.
11004271 2000 Q118X mutation of M1S1 gene caused gelatinous drop-like corneal dystrophy: the P501T of BIGH3 gene found in a family with gelatinous drop-like corneal dystrophy.
10937555 2000 Rapid detection of M1S1 mutations by the protein truncation test.
10928776 2000 Epithelial barrier function and ultrastructure of gelatinous drop-like corneal dystrophy.
10844062 2000 Gelatino-lattice corneal dystrophy: clinical features and mutational analysis.
10192395 1999 Identification of the gene responsible for gelatinous drop-like corneal dystrophy.
9610724 1998 Human Trop-2 is a tumor-associated calcium signal transducer.
9462726 1998 Cloning of the murine TROP2 gene: conservation of a PIP2-binding sequence in the cytoplasmic domain of TROP-2.
8382772 1993 Retroposition in a family of carcinoma-associated antigen genes.
7665234 1995 Cloning of the gene encoding Trop-2, a cell-surface glycoprotein expressed by human carcinomas.
2911574 1989 Sequence investigation of the major gastrointestinal tumor-associated antigen gene family, GA733.